Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM3_RS06785 | Genome accession | NC_004070 |
| Coordinates | 1313282..1313464 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes MGAS315 | ||
| Function | Inhibit ComR activation Competence regulation |
||
Function
In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.
Genomic Context
Location: 1308282..1318464
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM3_RS06775 (SpyM3_1298) | rocA | 1309717..1311071 (-) | 1355 | Protein_1314 | transcriptional regulator RocA | - |
| SPYM3_RS06780 (SpyM3_1299) | rlmD | 1311736..1313091 (-) | 1356 | WP_002991789.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| SPYM3_RS06785 (SpyM3_1300) | prx | 1313282..1313464 (-) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
| SPYM3_RS06790 (SpyM3_1301) | speA | 1313684..1314439 (+) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| SPYM3_RS06795 (SpyM3_1302) | - | 1314561..1315220 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| SPYM3_RS06800 (SpyM3_1303) | - | 1315220..1315441 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| SPYM3_RS06805 (SpyM3_1304) | - | 1315451..1316224 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| SPYM3_RS06810 (SpyM3_1305) | - | 1316235..1316837 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| SPYM3_RS06815 (SpyM3_1306) | - | 1316849..1317613 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| SPYM3_RS06820 (SpyM3_1307) | - | 1317615..1317947 (-) | 333 | WP_011054798.1 | phage holin | - |
| SPYM3_RS10645 (SpyM3_1308) | - | 1318283..1318405 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| prx | comR | negative effect |
| comR | comX/sigX/comX2/sigX2 | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comR | comX/sigX/comX1/sigX1 | positive effect |
| comS | comX/sigX/comX1/sigX1 | positive effect |
| clpP | comX/sigX/comX1/sigX1 | negative effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comS | comX/sigX/comX2/sigX2 | positive effect |
| clpP | comX/sigX/comX2/sigX2 | negative effect |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |
Multiple sequence alignment
References
| [1] | Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983] |