Detailed information NTG0000546

Experimentally validated

Overview

• Name: prx
• Type: Regulator
• Locus tag: SPYM3_RS04035
• Genome accession: NC_004070
• Coordinates: 788375..788557 (+)
• Length: 60 a.a.
• NCBI ID: WP_029714017.1
• Uniprot ID: A0A5S4TLJ0
• Organism: Streptococcus pyogenes MGAS315
• Function: Inhibit ComR activation Competence regulation

Function

In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.

Genomic Context

Location: 783375..793557

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPYM3_RS03990 (SpyM3_0728)	-	783778..784410 (+)	633	WP_011054443.1	hypothetical protein	-
SPYM3_RS03995 (SpyM3_0729)	-	784422..784694 (+)	273	WP_011017397.1	DUF7365 family protein	-
SPYM3_RS04000 (SpyM3_0730)	-	784691..784918 (+)	228	WP_011054444.1	phage holin	-
SPYM3_RS04010 (SpyM3_0731)	-	785034..786242 (+)	1209	WP_011054445.1	glucosaminidase domain-containing protein	-
SPYM3_RS04015 (SpyM3_0732)	-	786358..786714 (-)	357	WP_011054446.1	hypothetical protein	-
SPYM3_RS04020 (SpyM3_0733)	-	786772..787011 (-)	240	WP_011054447.1	hypothetical protein	-
SPYM3_RS04025 (SpyM3_0734)	-	787275..787526 (-)	252	WP_011054448.1	hypothetical protein	-
SPYM3_RS10330 (SpyM3_0735)	-	787667..787813 (-)	147	WP_011054449.1	hypothetical protein	-
SPYM3_RS04030 (SpyM3_0736)	-	787967..788176 (+)	210	WP_011054450.1	helix-turn-helix domain-containing protein	-
SPYM3_RS04035	prx	788375..788557 (+)	183	WP_029714017.1	hypothetical protein	Regulator
SPYM3_RS10335	-	788780..789186 (+)	407	Protein_761	nucleoside-diphosphate kinase	-
SPYM3_RS04045 (SpyM3_0737)	lepA	789310..791142 (+)	1833	WP_011054451.1	translation elongation factor 4	-
SPYM3_RS10670 (SpyM3_0738)	slc2	791329..793050 (+)	1722	WP_011054452.1	LPXTG-anchored collagen-like adhesin Scl2/SclB	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
prx	comR	negative effect
comR	comX/sigX/comX2/sigX2	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comR	comX/sigX/comX1/sigX1	positive effect
comS	comX/sigX/comX1/sigX1	positive effect
clpP	comX/sigX/comX1/sigX1	negative effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comS	comX/sigX/comX2/sigX2	positive effect
clpP	comX/sigX/comX2/sigX2	negative effect

Sequence

Protein

• Length: 60 a.a.
• Molecular weight: 6890.90 Da
• Isoelectric Point: 4.1947

>NTDB_id=546 SPYM3_RS04035 WP_029714017.1 788375..788557(+) (prx) [Streptococcus pyogenes MGAS315]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK

Nucleotide

• Length: 183 bp

>NTDB_id=546 SPYM3_RS04035 WP_029714017.1 788375..788557(+) (prx) [Streptococcus pyogenes MGAS315]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
prx	Streptococcus pyogenes MGAS315	80	100	0.8
prx	Streptococcus pyogenes MGAS315	76.667	100	0.767
prx	Streptococcus pyogenes MGAS315	75	100	0.75
prx	Streptococcus pyogenes MGAS315	77.966	95.161	0.742
prx	Streptococcus pyogenes MGAS8232	73.333	100	0.733
prx	Streptococcus pyogenes MGAS315	73.333	100	0.733

References

• [1]: Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983]