Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM3_RS04035 | Genome accession | NC_004070 |
| Coordinates | 788375..788557 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes MGAS315 | ||
| Function | Inhibit ComR activation Competence regulation |
||
Function
In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.
Genomic Context
Location: 783375..793557
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM3_RS03990 (SpyM3_0728) | - | 783778..784410 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| SPYM3_RS03995 (SpyM3_0729) | - | 784422..784694 (+) | 273 | WP_011017397.1 | DUF7365 family protein | - |
| SPYM3_RS04000 (SpyM3_0730) | - | 784691..784918 (+) | 228 | WP_011054444.1 | phage holin | - |
| SPYM3_RS04010 (SpyM3_0731) | - | 785034..786242 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| SPYM3_RS04015 (SpyM3_0732) | - | 786358..786714 (-) | 357 | WP_011054446.1 | hypothetical protein | - |
| SPYM3_RS04020 (SpyM3_0733) | - | 786772..787011 (-) | 240 | WP_011054447.1 | hypothetical protein | - |
| SPYM3_RS04025 (SpyM3_0734) | - | 787275..787526 (-) | 252 | WP_011054448.1 | hypothetical protein | - |
| SPYM3_RS10330 (SpyM3_0735) | - | 787667..787813 (-) | 147 | WP_011054449.1 | hypothetical protein | - |
| SPYM3_RS04030 (SpyM3_0736) | - | 787967..788176 (+) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| SPYM3_RS04035 | prx | 788375..788557 (+) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
| SPYM3_RS10335 | - | 788780..789186 (+) | 407 | Protein_761 | nucleoside-diphosphate kinase | - |
| SPYM3_RS04045 (SpyM3_0737) | lepA | 789310..791142 (+) | 1833 | WP_011054451.1 | translation elongation factor 4 | - |
| SPYM3_RS10670 (SpyM3_0738) | slc2 | 791329..793050 (+) | 1722 | WP_011054452.1 | LPXTG-anchored collagen-like adhesin Scl2/SclB | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| prx | comR | negative effect |
| comR | comX/sigX/comX2/sigX2 | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comR | comX/sigX/comX1/sigX1 | positive effect |
| comS | comX/sigX/comX1/sigX1 | positive effect |
| clpP | comX/sigX/comX1/sigX1 | negative effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comS | comX/sigX/comX2/sigX2 | positive effect |
| clpP | comX/sigX/comX2/sigX2 | negative effect |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |