Detailed information
Experimentally validated
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM18_RS06215 | Genome accession | NC_003485 |
| Coordinates | 1206360..1206542 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS8232 | ||
| Function | Inhibit ComR activation Competence regulation |
||
Function
In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1206360..1243304 | 1206360..1206542 | within | 0 |
Gene organization within MGE regions
Location: 1206360..1243304
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM18_RS06215 (spyM18_1444) | prx | 1206360..1206542 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| SPYM18_RS06220 (spyM18_1446) | sda3 | 1206782..1207582 (+) | 801 | WP_011017965.1 | streptodornase Sda3 | - |
| SPYM18_RS06225 (spyM18_1447) | - | 1207851..1208285 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| SPYM18_RS06230 (spyM18_1448) | - | 1208355..1209560 (-) | 1206 | WP_011017967.1 | glucosaminidase domain-containing protein | - |
| SPYM18_RS06240 (spyM18_1450) | - | 1209676..1209903 (-) | 228 | WP_000609113.1 | phage holin | - |
| SPYM18_RS06245 (spyM18_1451) | - | 1209900..1210175 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| SPYM18_RS06250 (spyM18_1452) | - | 1210185..1210802 (-) | 618 | WP_011017592.1 | DUF1366 domain-containing protein | - |
| SPYM18_RS06255 (spyM18_1453) | - | 1210805..1211236 (-) | 432 | WP_011017968.1 | DUF1617 family protein | - |
| SPYM18_RS06260 (spyM18_1454) | - | 1211248..1213032 (-) | 1785 | WP_011017969.1 | gp58-like family protein | - |
| SPYM18_RS06265 (spyM18_1455) | - | 1213047..1214048 (-) | 1002 | WP_011017970.1 | hyaluronoglucosaminidase | - |
| SPYM18_RS06270 (spyM18_1456) | - | 1214048..1216021 (-) | 1974 | WP_032465685.1 | phage tail spike protein | - |
| SPYM18_RS06275 (spyM18_1457) | - | 1216003..1216698 (-) | 696 | WP_011017972.1 | hypothetical protein | - |
| SPYM18_RS10690 | - | 1216695..1218524 (-) | 1830 | Protein_1220 | hypothetical protein | - |
| SPYM18_RS06285 (spyM18_1461) | - | 1218711..1219271 (-) | 561 | WP_011017973.1 | HNH endonuclease | - |
| SPYM18_RS06290 (spyM18_1462) | - | 1219444..1219971 (-) | 528 | Protein_1222 | hypothetical protein | - |
| SPYM18_RS06295 (spyM18_1463) | - | 1219971..1220342 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| SPYM18_RS06300 (spyM18_1464) | - | 1220357..1220620 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPYM18_RS06305 (spyM18_1465) | - | 1220631..1221224 (-) | 594 | WP_010922456.1 | tail protein | - |
| SPYM18_RS06310 (spyM18_1466) | - | 1221236..1221571 (-) | 336 | WP_011017974.1 | hypothetical protein | - |
| SPYM18_RS06315 (spyM18_1467) | - | 1221572..1221808 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| SPYM18_RS06320 (spyM18_1468) | - | 1221801..1222139 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| SPYM18_RS06325 (spyM18_1469) | - | 1222099..1222521 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPYM18_RS06330 (spyM18_1470) | - | 1222531..1222731 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPYM18_RS06335 (spyM18_1471) | - | 1222731..1223642 (-) | 912 | WP_011017975.1 | phage major capsid protein | - |
| SPYM18_RS06340 (spyM18_1472) | - | 1223667..1224128 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SPYM18_RS06345 (spyM18_1474) | - | 1224210..1225625 (-) | 1416 | WP_011017976.1 | terminase | - |
| SPYM18_RS06350 (spyM18_1475) | - | 1225707..1225943 (-) | 237 | WP_011888764.1 | hypothetical protein | - |
| SPYM18_RS06355 (spyM18_1476) | - | 1225945..1226211 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| SPYM18_RS10355 | - | 1226204..1226356 (-) | 153 | WP_023079491.1 | hypothetical protein | - |
| SPYM18_RS06360 (spyM18_1479) | - | 1226433..1226657 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| SPYM18_RS06365 (spyM18_1480) | - | 1226663..1228156 (-) | 1494 | WP_011017978.1 | hypothetical protein | - |
| SPYM18_RS06370 (spyM18_1481) | - | 1228149..1229417 (-) | 1269 | WP_011017979.1 | phage portal protein | - |
| SPYM18_RS06375 (spyM18_1482) | - | 1229414..1229770 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPYM18_RS06380 (spyM18_1484) | - | 1229920..1230264 (-) | 345 | WP_011017980.1 | HNH endonuclease signature motif containing protein | - |
| SPYM18_RS06385 (spyM18_1485) | - | 1230372..1230791 (-) | 420 | WP_003047501.1 | DUF1492 domain-containing protein | - |
| SPYM18_RS06390 (spyM18_1486) | - | 1230867..1231118 (-) | 252 | WP_011017981.1 | hypothetical protein | - |
| SPYM18_RS06395 (spyM18_1487) | - | 1231115..1231669 (-) | 555 | WP_011017982.1 | DUF1642 domain-containing protein | - |
| SPYM18_RS06400 (spyM18_1488) | - | 1231717..1232466 (-) | 750 | WP_079992696.1 | DNA-methyltransferase | - |
| SPYM18_RS06405 (spyM18_1489) | - | 1232469..1232660 (-) | 192 | WP_371249160.1 | hypothetical protein | - |
| SPYM18_RS10550 (spyM18_1490) | - | 1232739..1232924 (-) | 186 | WP_011017985.1 | hypothetical protein | - |
| SPYM18_RS06415 (spyM18_1491) | - | 1232911..1233423 (-) | 513 | WP_011017986.1 | hypothetical protein | - |
| SPYM18_RS06420 (spyM18_1492) | - | 1233420..1233761 (-) | 342 | WP_011888757.1 | hypothetical protein | - |
| SPYM18_RS10360 (spyM18_1493) | - | 1233939..1234106 (-) | 168 | WP_011017988.1 | hypothetical protein | - |
| SPYM18_RS06425 (spyM18_1494) | - | 1234116..1234913 (-) | 798 | WP_011017989.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPYM18_RS06430 (spyM18_1495) | - | 1234910..1235839 (-) | 930 | WP_011017990.1 | recombinase RecT | - |
| SPYM18_RS06435 (spyM18_1496) | - | 1235842..1236171 (-) | 330 | WP_011017991.1 | hypothetical protein | - |
| SPYM18_RS06440 (spyM18_1497) | - | 1236227..1236433 (-) | 207 | WP_002990074.1 | hypothetical protein | - |
| SPYM18_RS10365 (spyM18_1498) | - | 1236442..1236582 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| SPYM18_RS06445 (spyM18_1499) | - | 1236579..1236812 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| SPYM18_RS06450 (spyM18_1500) | - | 1236793..1237179 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| SPYM18_RS10555 | - | 1237320..1237589 (-) | 270 | WP_011106700.1 | replication protein | - |
| SPYM18_RS06460 (spyM18_1501) | - | 1237683..1237868 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPYM18_RS06465 (spyM18_1502) | - | 1237870..1238181 (-) | 312 | WP_010922478.1 | excisionase | - |
| SPYM18_RS06470 (spyM18_1503) | - | 1238451..1238663 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SPYM18_RS06475 (spyM18_1504) | - | 1238865..1239620 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| SPYM18_RS06480 (spyM18_1505) | - | 1239632..1240150 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SPYM18_RS06485 (spyM18_1506) | - | 1240274..1241416 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| SPYM18_RS06490 | - | 1241505..1241780 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPYM18_RS06495 (spyM18_1509) | - | 1241879..1242466 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| SPYM18_RS06500 (spyM18_1510) | - | 1242444..1243286 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| prx | comR | negative effect  |
| comR | comX/sigX/comX1/sigX1 | positive effect  |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comS | comX/sigX/comX1/sigX1 | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comR | comX/sigX/comX2/sigX2 | positive effect |
| comS | comX/sigX/comX2/sigX2 | positive effect |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=552 SPYM18_RS06215 WP_011017964.1 1206360..1206542(-) (prx) [Streptococcus pyogenes MGAS8232]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=552 SPYM18_RS06215 WP_011017964.1 1206360..1206542(-) (prx) [Streptococcus pyogenes MGAS8232]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
Multiple sequence alignment
References
| [1] | Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983] |