Detailed information NTG0000552

Experimentally validated

Overview

• Name: prx
• Type: Regulator
• Locus tag: SPYM18_RS06215
• Genome accession: NC_003485
• Coordinates: 1206360..1206542 (-)
• Length: 60 a.a.
• NCBI ID: WP_011017964.1
• Uniprot ID: -
• Organism: Streptococcus pyogenes MGAS8232
• Function: Inhibit ComR activation Competence regulation

Function

In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.

Genomic Context

Location: 1201360..1211542

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPYM18_RS06200 (spyM18_1439)	-	1201798..1202493 (-)	696	WP_002983928.1	phosphoglycerate mutase	-
SPYM18_RS06205 (spyM18_1441)	-	1202732..1203667 (+)	936	WP_011017961.1	dihydroorotate oxidase	-
SPYM18_RS06210 (spyM18_1443)	-	1203967..1205829 (-)	1863	WP_011017963.1	heavy metal translocating P-type ATPase	-
SPYM18_RS06215 (spyM18_1444)	prx	1206360..1206542 (-)	183	WP_011017964.1	hypothetical protein	Regulator
SPYM18_RS06220 (spyM18_1446)	sda3	1206782..1207582 (+)	801	WP_011017965.1	streptodornase Sda3	-
SPYM18_RS06225 (spyM18_1447)	-	1207851..1208285 (+)	435	WP_011017966.1	hypothetical protein	-
SPYM18_RS06230 (spyM18_1448)	-	1208355..1209560 (-)	1206	WP_011017967.1	glucosaminidase domain-containing protein	-
SPYM18_RS06240 (spyM18_1450)	-	1209676..1209903 (-)	228	WP_000609113.1	phage holin	-
SPYM18_RS06245 (spyM18_1451)	-	1209900..1210175 (-)	276	WP_002987582.1	DUF7365 family protein	-
SPYM18_RS06250 (spyM18_1452)	-	1210185..1210802 (-)	618	WP_011017592.1	DUF1366 domain-containing protein	-
SPYM18_RS06255 (spyM18_1453)	-	1210805..1211236 (-)	432	WP_011017968.1	DUF1617 family protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
prx	comR	negative effect
comR	comX/sigX/comX1/sigX1	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comX/sigX/comX1/sigX1	late competence genes	positive effect
comS	comX/sigX/comX1/sigX1	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comX/sigX/comX2/sigX2	late competence genes	positive effect
comR	comX/sigX/comX2/sigX2	positive effect
comS	comX/sigX/comX2/sigX2	positive effect

Sequence

Protein

• Length: 60 a.a.
• Molecular weight: 6841.79 Da
• Isoelectric Point: 4.5183

>NTDB_id=552 SPYM18_RS06215 WP_011017964.1 1206360..1206542(-) (prx) [Streptococcus pyogenes MGAS8232]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR

Nucleotide

• Length: 183 bp

>NTDB_id=552 SPYM18_RS06215 WP_011017964.1 1206360..1206542(-) (prx) [Streptococcus pyogenes MGAS8232]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
prx	Streptococcus pyogenes MGAS315	85	100	0.85
prx	Streptococcus pyogenes MGAS315	80	100	0.8
prx	Streptococcus pyogenes MGAS315	80	100	0.8
prx	Streptococcus pyogenes MGAS315	84.483	93.548	0.79
prx	Streptococcus pyogenes MGAS315	75	100	0.75
prx	Streptococcus pyogenes MGAS315	73.333	100	0.733

References

• [1]: Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983]