Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM3_RS07355 | Genome accession | NC_004070 |
| Coordinates | 1410725..1410907 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | A0A0H2UW47 |
| Organism | Streptococcus pyogenes MGAS315 | ||
| Function | Inhibit ComR activation Competence regulation |
||
Function
In vitro experiments demonstrate that Prx binds ComR directly and prevents the ComR-XIP complex from interacting with DNA. Mutations of prx in vivo caused increased expression of the late competence gene ssb when induced with XIP as compared to wild-type, and Prx orthologues are able to inhibit ComR activation by XIP in a reporter strain which lacks an endogenous prx. An X-ray crystal structure of Prx reveals a unique fold that implies a novel molecular mechanism to inhibit ComR.
Genomic Context
Location: 1405725..1415907
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM3_RS07330 (SpyM3_1402) | ftsL | 1406659..1406982 (-) | 324 | WP_002988895.1 | cell division protein FtsL | - |
| SPYM3_RS07335 (SpyM3_1403) | rsmH | 1406987..1407937 (-) | 951 | WP_002988893.1 | 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH | - |
| SPYM3_RS10405 (SpyM3_1404) | - | 1408024..1408188 (-) | 165 | WP_002994245.1 | hypothetical protein | - |
| SPYM3_RS07340 (SpyM3_1405) | - | 1408290..1408451 (-) | 162 | WP_159316501.1 | hypothetical protein | - |
| SPYM3_RS07345 (SpyM3_1406) | - | 1408471..1409721 (-) | 1251 | WP_011054854.1 | glutamate-5-semialdehyde dehydrogenase | - |
| SPYM3_RS07350 (SpyM3_1407) | proB | 1409714..1410535 (-) | 822 | WP_011054855.1 | glutamate 5-kinase | - |
| SPYM3_RS07355 (SpyM3_1408) | prx | 1410725..1410907 (-) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| SPYM3_RS07360 (SpyM3_1409) | - | 1411140..1412126 (+) | 987 | WP_048901986.1 | DNA/RNA non-specific endonuclease | - |
| SPYM3_RS07365 (SpyM3_1410) | - | 1412441..1412755 (-) | 315 | WP_228358673.1 | hypothetical protein | - |
| SPYM3_RS07370 | - | 1413077..1414279 (-) | 1203 | Protein_1427 | glucosaminidase domain-containing protein | - |
| SPYM3_RS07380 (SpyM3_1413) | - | 1414395..1414622 (-) | 228 | WP_003058873.1 | phage holin | - |
| SPYM3_RS07385 (SpyM3_1414) | - | 1414619..1414891 (-) | 273 | WP_002986916.1 | DUF7365 family protein | - |
| SPYM3_RS07390 (SpyM3_1415) | - | 1414901..1415518 (-) | 618 | WP_011054861.1 | DUF1366 domain-containing protein | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| prx | comR | negative effect |
| comR | comX/sigX/comX2/sigX2 | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comR | comX/sigX/comX1/sigX1 | positive effect |
| comS | comX/sigX/comX1/sigX1 | positive effect |
| clpP | comX/sigX/comX1/sigX1 | negative effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comS | comX/sigX/comX2/sigX2 | positive effect |
| clpP | comX/sigX/comX2/sigX2 | negative effect |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
Multiple sequence alignment
References
| [1] | Lauren Mashburn-Warren et al. (2018) The conserved mosaic prophage protein paratox inhibits the natural competence regulator ComR in Streptococcus. Scientific Reports 8(1):16535. [PMID: 30409983] |