Detailed information    

experimental Experimentally validated

Overview

Name   comS   Type   Regulator
Locus tag   SPYM3_RS10450 Genome accession   NC_004070
Coordinates   54476..54574 (+) Length   32 a.a.
NCBI ID   WP_020833188.1    Uniprot ID   -
Organism   Streptococcus pyogenes MGAS315     
Function   activate transcription of comX   
Competence regulation

Function

The last eight amino acids of both comS alleles produced the highest induction of sigX in GAS. Therefore, we refer here to the active synthetic peptide containing the last eight amino acids of ComS as XIP.


Genomic Context

Location: 49476..59574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPYM3_RS00315 (SpyM3_0029) - 50342..51682 (+) 1341 WP_002986685.1 hypothetical protein -
  SPYM3_RS00320 (SpyM3_0030) purB 52051..53343 (+) 1293 WP_011054098.1 adenylosuccinate lyase -
  SPYM3_RS00325 (SpyM3_0031) comR 53474..54385 (+) 912 WP_011054099.1 helix-turn-helix domain-containing protein Regulator
  SPYM3_RS10450 comS 54476..54574 (+) 99 WP_020833188.1 quorum-sensing system DWW-type pheromone Regulator
  SPYM3_RS00330 (SpyM3_0032) ruvB 54605..55603 (+) 999 WP_011054100.1 Holliday junction branch migration DNA helicase RuvB -
  SPYM3_RS00335 (SpyM3_0033) - 55741..56178 (+) 438 WP_002994668.1 low molecular weight protein-tyrosine-phosphatase -
  SPYM3_RS00340 (SpyM3_0034) - 56201..56602 (+) 402 WP_011017240.1 MORN repeat-containing protein -
  SPYM3_RS00345 (SpyM3_0035) - 56599..58374 (+) 1776 WP_011054101.1 acyltransferase family protein -

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  comS comX/sigX/comX1/sigX1 positive effect
  comX/sigX/comX1/sigX1 late competence genes positive effect
  comX/sigX/comX1/sigX1 late competence genes positive effect
  comX/sigX/comX2/sigX2 late competence genes positive effect
  comR comX/sigX/comX1/sigX1 positive effect
  comR comX/sigX/comX2/sigX2 positive effect
  prx comR negative effect
  comS comX/sigX/comX2/sigX2 positive effect
  clpP comX/sigX/comX1/sigX1 negative effect
  clpP comX/sigX/comX2/sigX2 negative effect
  comX/sigX/comX2/sigX2 late competence genes positive effect

Sequence

Protein


Download         Length: 32 a.a.        Molecular weight: 3758.63 Da        Isoelectric Point: 10.7919

>NTDB_id=444 SPYM3_RS10450 WP_020833188.1 54476..54574(+) (comS) [Streptococcus pyogenes MGAS315]
MLKKVKPFLLLAAVVAFKVARVMHEFDWWNLG

Nucleotide


Download         Length: 99 bp        

>NTDB_id=444 SPYM3_RS10450 WP_020833188.1 54476..54574(+) (comS) [Streptococcus pyogenes MGAS315]
ATGTTAAAAAAAGTTAAGCCATTTTTACTATTAGCCGCAGTAGTTGCATTTAAAGTTGCTCGTGTAATGCATGAATTTGA
TTGGTGGAATCTTGGTTAA

XIP

This gene is known to encode the precursor of σX inducing peptide (XIP), which involves in competence development. The mature XIP sequence is displayed as below:

FDWWNLG


Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comS Streptococcus pyogenes MGAS8232

45.161

100

0.452

Multiple sequence alignment    



References

[1] Lauren Mashburn-Warren et al. (2012) The cryptic competence pathway in Streptococcus pyogenes is controlled by a peptide pheromone. Journal of Bacteriology 194(17):4589-600. [PMID: 22730123]