Detailed information NTG0183097

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLUC06_RS12070
• Genome accession: NZ_CP015902
• Coordinates: 2402381..2402764 (-)
• Length: 127 a.a.
• NCBI ID: WP_012898622.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain UC06
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2397381..2407764

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC06_RS12030 (LLUC06_2339)	-	2397917..2398726 (-)	810	WP_014570791.1	metal ABC transporter permease	-
LLUC06_RS12035 (LLUC06_2340)	-	2398719..2399456 (-)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
LLUC06_RS12040 (LLUC06_2341)	-	2399633..2400475 (-)	843	WP_081213761.1	metal ABC transporter substrate-binding protein	-
LLUC06_RS12045 (LLUC06_2342)	-	2400472..2400909 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
LLUC06_RS12050 (LLUC06_2343)	comGG	2400990..2401274 (-)	285	WP_017865155.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC06_RS12055 (LLUC06_2344)	comGF	2401313..2401759 (-)	447	WP_058203710.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC06_RS12060 (LLUC06_2345)	comGE	2401722..2402018 (-)	297	WP_033900709.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC06_RS12065 (LLUC06_2346)	comGD	2401990..2402421 (-)	432	WP_012898621.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLUC06_RS12070 (LLUC06_2347)	comGC	2402381..2402764 (-)	384	WP_012898622.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC06_RS12075 (LLUC06_2348)	comGB	2402778..2403851 (-)	1074	WP_081213814.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC06_RS12080 (LLUC06_2349)	comGA	2403745..2404682 (-)	938	Protein_2349	competence type IV pilus ATPase ComGA	-

Sequence

Protein

• Length: 127 a.a.
• Molecular weight: 14825.41 Da
• Isoelectric Point: 8.4563

>NTDB_id=183097 LLUC06_RS12070 WP_012898622.1 2402381..2402764(-) (comGC) [Lactococcus lactis subsp. lactis strain UC06]
MERTKKFILKKIQKIFLFVKICEKKCRQKELRAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA
QLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

• Length: 384 bp

>NTDB_id=183097 LLUC06_RS12070 WP_012898622.1 2402381..2402764(-) (comGC) [Lactococcus lactis subsp. lactis strain UC06]
ATGGAAAGAACTAAGAAGTTTATTTTAAAGAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG
TCAGAAAGAGCTAAGAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG
TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCT
CAACTTTATGAATTAGATCATGATGATGAGAAGCCGAGTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACA
AATTTCTGCTTACGATAATTACTATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (32-52)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	80.172	91.339	0.732
comYC	Streptococcus mutans UA159	56.436	79.528	0.449
comYC	Streptococcus mutans UA140	56.436	79.528	0.449
comGC/cglC	Streptococcus mitis SK321	55.446	79.528	0.441
comYC	Streptococcus gordonii str. Challis substr. CH1	55.556	77.953	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae D39	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae R6	53.465	79.528	0.425
comGC/cglC	Streptococcus mitis NCTC 12261	57.303	70.079	0.402
comYC	Streptococcus suis isolate S10	55.682	69.291	0.386