Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLUC06_RS12050 Genome accession   NZ_CP015902
Coordinates   2400990..2401274 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain UC06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2395990..2406274
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC06_RS12020 (LLUC06_2337) - 2396431..2396808 (-) 378 WP_081213760.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLUC06_RS12025 (LLUC06_2338) - 2397013..2397879 (+) 867 WP_058203713.1 RluA family pseudouridine synthase -
  LLUC06_RS12030 (LLUC06_2339) - 2397917..2398726 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLUC06_RS12035 (LLUC06_2340) - 2398719..2399456 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLUC06_RS12040 (LLUC06_2341) - 2399633..2400475 (-) 843 WP_081213761.1 metal ABC transporter substrate-binding protein -
  LLUC06_RS12045 (LLUC06_2342) - 2400472..2400909 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LLUC06_RS12050 (LLUC06_2343) comGG 2400990..2401274 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC06_RS12055 (LLUC06_2344) comGF 2401313..2401759 (-) 447 WP_058203710.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC06_RS12060 (LLUC06_2345) comGE 2401722..2402018 (-) 297 WP_033900709.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC06_RS12065 (LLUC06_2346) comGD 2401990..2402421 (-) 432 WP_012898621.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLUC06_RS12070 (LLUC06_2347) comGC 2402381..2402764 (-) 384 WP_012898622.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC06_RS12075 (LLUC06_2348) comGB 2402778..2403851 (-) 1074 WP_081213814.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUC06_RS12080 (LLUC06_2349) comGA 2403745..2404682 (-) 938 Protein_2349 competence type IV pilus ATPase ComGA -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=183093 LLUC06_RS12050 WP_017865155.1 2400990..2401274(-) (comGG) [Lactococcus lactis subsp. lactis strain UC06]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=183093 LLUC06_RS12050 WP_017865155.1 2400990..2401274(-) (comGG) [Lactococcus lactis subsp. lactis strain UC06]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596


Multiple sequence alignment