NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	A7J08_RS00900	Genome accession	NZ_CP017088
Coordinates	146999..147280 (+)	Length	93 a.a.
NCBI ID	WP_053866667.1	Uniprot ID	-
Organism	Streptococcus suis strain SRD478
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 141999..152280

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A7J08_RS00880 (A7J08_00875)	-	143507..143881 (+)	375	WP_024385120.1	DUF1033 family protein	-
A7J08_RS00885 (A7J08_00880)	-	143915..144826 (-)	912	Protein_136	S66 peptidase family protein	-
A7J08_RS00890 (A7J08_00885)	comGA	145098..146048 (+)	951	WP_053867353.1	competence type IV pilus ATPase ComGA	Machinery gene
A7J08_RS00895 (A7J08_00890)	comGB	145960..146997 (+)	1038	WP_238600014.1	competence type IV pilus assembly protein ComGB	Machinery gene
A7J08_RS00900 (A7J08_00895)	comGC	146999..147280 (+)	282	WP_053866667.1	competence type IV pilus major pilin ComGC	Machinery gene
A7J08_RS00905 (A7J08_00900)	comGD	147261..147668 (+)	408	WP_053866668.1	competence type IV pilus minor pilin ComGD	Machinery gene
A7J08_RS00910 (A7J08_00905)	comGE	147640..147933 (+)	294	WP_053866669.1	competence type IV pilus minor pilin ComGE	Machinery gene
A7J08_RS00915 (A7J08_00910)	comGF/cglF	147920..148354 (+)	435	WP_053866670.1	competence type IV pilus minor pilin ComGF	Machinery gene
A7J08_RS00920 (A7J08_00915)	comGG	148332..148745 (+)	414	WP_053866671.1	competence type IV pilus minor pilin ComGG	-
A7J08_RS00925 (A7J08_00920)	comGH	148795..149748 (+)	954	WP_053866672.1	class I SAM-dependent methyltransferase	Machinery gene
A7J08_RS00930 (A7J08_00925)	-	149798..150985 (+)	1188	WP_053866673.1	acetate kinase	-
A7J08_RS00940 (A7J08_00930)	-	151299..151850 (+)	552	WP_053866674.1	folate family ECF transporter S component	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10390.31 Da Isoelectric Point: 7.0116

                                >NTDB_id=165985 A7J08_RS00900 WP_053866667.1 146999..147280(+) (comGC) [Streptococcus suis strain SRD478]

MKKLIEVKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDVVQKKGNAAVVKVVESQMELYELEHDTEATVAELQAKGYI

TEKQAEQYATAKK

Nucleotide

Download Length: 282 bp

                                >NTDB_id=165985 A7J08_RS00900 WP_053866667.1 146999..147280(+) (comGC) [Streptococcus suis strain SRD478]

ATGAAAAAGTTAATTGAAGTGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGAATTATTAGCCTGCT

CTTGCTCCTTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGTTGTTCAGAAGAAGGGGAATGCGGCAGTTGTCAAAGTAG

TGGAGAGTCAAATGGAGCTCTATGAATTGGAACATGACACGGAAGCAACGGTGGCAGAGTTGCAGGCGAAAGGCTATATT

ACTGAAAAACAAGCGGAGCAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Streptococcus suis isolate S10	91.398	100	0.914
comGC/cglC	Streptococcus pneumoniae TIGR4	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae Rx1	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae D39	63.043	98.925	0.624
comGC/cglC	Streptococcus pneumoniae R6	63.043	98.925	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	63.043	98.925	0.624
comGC/cglC	Streptococcus mitis SK321	63.043	98.925	0.624
comGC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comGC	Streptococcus mutans UA140	62.5	94.624	0.591
comGC	Streptococcus mutans UA159	62.5	94.624	0.591
comGC	Lactococcus lactis subsp. cremoris KW2	59.091	94.624	0.559
comGC	Staphylococcus aureus MW2	47.436	83.871	0.398
comGC	Staphylococcus aureus N315	47.436	83.871	0.398
comGC	Bacillus subtilis subsp. subtilis str. 168	47.222	77.419	0.366

Detailed information NTG0165985