Detailed information
Bioinformatically predicted
Overview
| Name | comF | Type | Machinery gene |
| Locus tag | AUC44_RS12725 | Genome accession | NZ_CP013910 |
| Coordinates | 2613708..2614307 (-) | Length | 199 a.a. |
| NCBI ID | WP_062159089.1 | Uniprot ID | - |
| Organism | Deinococcus actinosclerus strain BM2 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2571597..2613722 | 2613708..2614307 | flank | -14 |
Gene organization within MGE regions
Location: 2571597..2614307
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUC44_RS12475 (AUC44_12455) | - | 2571597..2572202 (-) | 606 | WP_062159041.1 | glycoside hydrolase family 108 protein | - |
| AUC44_RS12480 (AUC44_12460) | - | 2572192..2572521 (-) | 330 | WP_157445351.1 | hypothetical protein | - |
| AUC44_RS12485 (AUC44_12465) | - | 2572530..2572880 (-) | 351 | WP_157445352.1 | hypothetical protein | - |
| AUC44_RS12490 (AUC44_12470) | - | 2572861..2573052 (-) | 192 | WP_058975531.1 | hypothetical protein | - |
| AUC44_RS12495 (AUC44_12475) | - | 2573178..2575679 (-) | 2502 | WP_062159044.1 | hypothetical protein | - |
| AUC44_RS12500 (AUC44_12480) | - | 2575688..2576122 (-) | 435 | WP_062159045.1 | hypothetical protein | - |
| AUC44_RS12505 (AUC44_12485) | - | 2576119..2577624 (-) | 1506 | WP_157445353.1 | hypothetical protein | - |
| AUC44_RS12510 (AUC44_12490) | - | 2577635..2581453 (-) | 3819 | WP_197408538.1 | phage tail tape measure protein | - |
| AUC44_RS16250 | - | 2581803..2582399 (-) | 597 | WP_197408539.1 | HNH endonuclease | - |
| AUC44_RS17375 | - | 2582392..2582712 (-) | 321 | WP_082689058.1 | HNH endonuclease | - |
| AUC44_RS12515 (AUC44_12495) | - | 2582712..2583005 (-) | 294 | WP_157445354.1 | hypothetical protein | - |
| AUC44_RS16600 (AUC44_12500) | - | 2583050..2583307 (-) | 258 | WP_335338667.1 | hypothetical protein | - |
| AUC44_RS16260 | - | 2583449..2583661 (+) | 213 | WP_231724438.1 | helix-turn-helix domain-containing protein | - |
| AUC44_RS16605 | - | 2583679..2585277 (-) | 1599 | WP_157445356.1 | hypothetical protein | - |
| AUC44_RS12525 (AUC44_12505) | - | 2585462..2585755 (-) | 294 | WP_157445357.1 | hypothetical protein | - |
| AUC44_RS12530 (AUC44_12510) | - | 2585843..2586145 (-) | 303 | WP_062159051.1 | hypothetical protein | - |
| AUC44_RS12535 (AUC44_12515) | - | 2586163..2586657 (-) | 495 | WP_157445358.1 | hypothetical protein | - |
| AUC44_RS12540 (AUC44_12520) | - | 2586654..2586893 (-) | 240 | WP_062159053.1 | hypothetical protein | - |
| AUC44_RS12545 (AUC44_12525) | - | 2586896..2587357 (-) | 462 | WP_062159054.1 | hypothetical protein | - |
| AUC44_RS12550 (AUC44_12530) | - | 2587360..2587704 (-) | 345 | WP_062159055.1 | DUF3168 domain-containing protein | - |
| AUC44_RS16840 (AUC44_12535) | - | 2587701..2587973 (-) | 273 | WP_062159056.1 | HK97 gp10 family phage protein | - |
| AUC44_RS16845 (AUC44_12540) | - | 2587970..2588287 (-) | 318 | WP_062159057.1 | hypothetical protein | - |
| AUC44_RS16615 (AUC44_12545) | - | 2588287..2588823 (-) | 537 | WP_062159058.1 | hypothetical protein | - |
| AUC44_RS12570 (AUC44_12550) | - | 2588792..2589217 (-) | 426 | WP_062159059.1 | hypothetical protein | - |
| AUC44_RS12575 (AUC44_12555) | - | 2589270..2590526 (-) | 1257 | WP_062159060.1 | phage major capsid protein | - |
| AUC44_RS12580 (AUC44_12560) | - | 2590523..2591368 (-) | 846 | WP_062159061.1 | HK97 family phage prohead protease | - |
| AUC44_RS16620 | - | 2591445..2591726 (-) | 282 | WP_157445360.1 | hypothetical protein | - |
| AUC44_RS16625 | - | 2591727..2591927 (-) | 201 | WP_157445361.1 | hypothetical protein | - |
| AUC44_RS12585 (AUC44_12565) | - | 2591932..2593908 (-) | 1977 | WP_062159062.1 | phage portal protein | - |
| AUC44_RS12590 (AUC44_12570) | - | 2593922..2595259 (-) | 1338 | WP_062159063.1 | hypothetical protein | - |
| AUC44_RS12595 (AUC44_12575) | - | 2595256..2595984 (-) | 729 | WP_157445362.1 | terminase small subunit | - |
| AUC44_RS16630 | - | 2596020..2596316 (+) | 297 | WP_157445363.1 | hypothetical protein | - |
| AUC44_RS12600 (AUC44_12580) | - | 2597214..2597729 (-) | 516 | WP_062159065.1 | hypothetical protein | - |
| AUC44_RS12605 (AUC44_12585) | - | 2597726..2598070 (-) | 345 | WP_197408541.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AUC44_RS16635 | - | 2598067..2598222 (-) | 156 | WP_157445364.1 | hypothetical protein | - |
| AUC44_RS12610 (AUC44_12590) | - | 2598219..2598413 (-) | 195 | WP_062159066.1 | hypothetical protein | - |
| AUC44_RS12615 (AUC44_12595) | - | 2598410..2598664 (-) | 255 | WP_062159067.1 | hypothetical protein | - |
| AUC44_RS12620 (AUC44_12600) | - | 2598661..2599053 (-) | 393 | WP_157445365.1 | hypothetical protein | - |
| AUC44_RS12625 (AUC44_12605) | - | 2599064..2599660 (-) | 597 | WP_062159069.1 | hypothetical protein | - |
| AUC44_RS12630 (AUC44_12610) | - | 2599944..2602673 (-) | 2730 | WP_062159070.1 | bifunctional DNA primase/polymerase | - |
| AUC44_RS17380 | - | 2602670..2603896 (-) | 1227 | WP_417926375.1 | DNA cytosine methyltransferase | - |
| AUC44_RS17105 (AUC44_12620) | - | 2603837..2603986 (+) | 150 | WP_231724439.1 | hypothetical protein | - |
| AUC44_RS12645 (AUC44_12625) | - | 2604148..2604396 (-) | 249 | WP_062159073.1 | hypothetical protein | - |
| AUC44_RS12650 (AUC44_12630) | - | 2604514..2605152 (-) | 639 | WP_062159074.1 | hypothetical protein | - |
| AUC44_RS12655 (AUC44_12635) | - | 2605279..2605464 (-) | 186 | WP_157445366.1 | hypothetical protein | - |
| AUC44_RS12660 (AUC44_12640) | - | 2605485..2605814 (-) | 330 | WP_062159076.1 | hypothetical protein | - |
| AUC44_RS12665 (AUC44_12645) | - | 2605811..2606083 (-) | 273 | WP_062159077.1 | hypothetical protein | - |
| AUC44_RS12670 (AUC44_12650) | - | 2606077..2606286 (-) | 210 | WP_062159078.1 | hypothetical protein | - |
| AUC44_RS12675 (AUC44_12655) | - | 2606286..2606489 (-) | 204 | WP_062159079.1 | hypothetical protein | - |
| AUC44_RS12680 (AUC44_12660) | - | 2606486..2606677 (-) | 192 | WP_062159080.1 | hypothetical protein | - |
| AUC44_RS12685 (AUC44_12665) | - | 2606674..2606967 (-) | 294 | WP_062159081.1 | hypothetical protein | - |
| AUC44_RS16640 | - | 2607028..2607183 (-) | 156 | WP_157445367.1 | hypothetical protein | - |
| AUC44_RS12690 (AUC44_12670) | - | 2607180..2607935 (-) | 756 | WP_157445368.1 | hypothetical protein | - |
| AUC44_RS12695 (AUC44_12675) | - | 2608000..2608224 (-) | 225 | WP_062159083.1 | helix-turn-helix transcriptional regulator | - |
| AUC44_RS16850 | - | 2608283..2608900 (+) | 618 | WP_197408542.1 | helix-turn-helix domain-containing protein | - |
| AUC44_RS17110 | - | 2608860..2609219 (+) | 360 | Protein_2574 | ImmA/IrrE family metallo-endopeptidase | - |
| AUC44_RS16280 | - | 2609305..2610078 (-) | 774 | WP_082688957.1 | IS982 family transposase | - |
| AUC44_RS12710 (AUC44_12690) | - | 2610167..2610391 (+) | 225 | WP_157445370.1 | hypothetical protein | - |
| AUC44_RS12715 (AUC44_12695) | - | 2610477..2610869 (+) | 393 | WP_062159087.1 | hypothetical protein | - |
| AUC44_RS16645 | - | 2611053..2611919 (+) | 867 | WP_157445371.1 | hypothetical protein | - |
| AUC44_RS12720 (AUC44_12700) | - | 2612310..2613722 (+) | 1413 | WP_062159088.1 | recombinase family protein | - |
| AUC44_RS12725 (AUC44_12705) | comF | 2613708..2614307 (-) | 600 | WP_062159089.1 | ComF family protein | Machinery gene |
Sequence
Protein
Download Length: 199 a.a. Molecular weight: 21345.76 Da Isoelectric Point: 11.8368
>NTDB_id=165983 AUC44_RS12725 WP_062159089.1 2613708..2614307(-) (comF) [Deinococcus actinosclerus strain BM2]
MTAAFGTALLGALRTLLPRACPGCGAQLGAHAGLCPACRAALRPQVQAHSPLRAHPEPHLVTLGTYSGVRRRAVRELKFA
QARDLARVLGETLATGVPDTWNVQAVIPVPLHPTRQRERGFNQSELLGRALAGALAVPCVPALTRTRAGAQQARRHGAQR
EDLHGAFRAHEGFLPTGAVLLIDDVLTTTSPLMHWLRRV
MTAAFGTALLGALRTLLPRACPGCGAQLGAHAGLCPACRAALRPQVQAHSPLRAHPEPHLVTLGTYSGVRRRAVRELKFA
QARDLARVLGETLATGVPDTWNVQAVIPVPLHPTRQRERGFNQSELLGRALAGALAVPCVPALTRTRAGAQQARRHGAQR
EDLHGAFRAHEGFLPTGAVLLIDDVLTTTSPLMHWLRRV
Nucleotide
Download Length: 600 bp
>NTDB_id=165983 AUC44_RS12725 WP_062159089.1 2613708..2614307(-) (comF) [Deinococcus actinosclerus strain BM2]
ATGACCGCTGCGTTCGGAACGGCCCTGCTCGGCGCGCTGCGCACCCTGCTGCCCCGCGCCTGCCCCGGCTGCGGCGCGCA
GCTCGGGGCGCACGCCGGACTGTGCCCCGCCTGCCGCGCCGCCCTGCGCCCCCAGGTGCAGGCCCACAGTCCCCTGCGCG
CCCACCCGGAGCCGCACCTCGTGACGCTCGGGACCTACAGCGGCGTGCGCCGGCGCGCCGTGCGGGAACTGAAATTCGCG
CAGGCCCGCGACCTCGCCCGCGTCCTCGGGGAGACCCTCGCCACCGGCGTGCCCGACACCTGGAACGTGCAGGCGGTCAT
CCCGGTGCCGCTGCATCCCACCCGGCAGCGCGAACGCGGCTTCAACCAGTCGGAACTGCTGGGCCGCGCCCTGGCCGGCG
CCCTGGCGGTGCCGTGCGTGCCCGCCCTGACCCGCACCCGCGCTGGCGCGCAGCAGGCCCGGCGTCACGGCGCGCAGCGC
GAGGACCTCCACGGGGCCTTCCGCGCCCACGAGGGCTTCCTGCCCACCGGCGCGGTGCTGCTGATCGACGACGTGCTCAC
CACCACATCGCCACTCATGCACTGGCTACGACGGGTCTAG
ATGACCGCTGCGTTCGGAACGGCCCTGCTCGGCGCGCTGCGCACCCTGCTGCCCCGCGCCTGCCCCGGCTGCGGCGCGCA
GCTCGGGGCGCACGCCGGACTGTGCCCCGCCTGCCGCGCCGCCCTGCGCCCCCAGGTGCAGGCCCACAGTCCCCTGCGCG
CCCACCCGGAGCCGCACCTCGTGACGCTCGGGACCTACAGCGGCGTGCGCCGGCGCGCCGTGCGGGAACTGAAATTCGCG
CAGGCCCGCGACCTCGCCCGCGTCCTCGGGGAGACCCTCGCCACCGGCGTGCCCGACACCTGGAACGTGCAGGCGGTCAT
CCCGGTGCCGCTGCATCCCACCCGGCAGCGCGAACGCGGCTTCAACCAGTCGGAACTGCTGGGCCGCGCCCTGGCCGGCG
CCCTGGCGGTGCCGTGCGTGCCCGCCCTGACCCGCACCCGCGCTGGCGCGCAGCAGGCCCGGCGTCACGGCGCGCAGCGC
GAGGACCTCCACGGGGCCTTCCGCGCCCACGAGGGCTTCCTGCCCACCGGCGCGGTGCTGCTGATCGACGACGTGCTCAC
CACCACATCGCCACTCATGCACTGGCTACGACGGGTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comF | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
62.366 |
93.467 |
0.583 |