Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilA/ppdD   Type   Machinery gene
Locus tag   BW25113_RS00535 Genome accession   NZ_CP009273
Coordinates   113596..114036 (-) Length   146 a.a.
NCBI ID   WP_000360904.1    Uniprot ID   P36647
Organism   Escherichia coli BW25113 strain K-12     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 108596..119036
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BW25113_RS00515 (BW25113_0103) coaE 109086..109706 (-) 621 WP_001269520.1 dephospho-CoA kinase -
  BW25113_RS25965 - 109731..109775 (+) 45 WP_120795372.1 protein YacM -
  BW25113_RS00520 (BW25113_0104) guaC 109931..110974 (+) 1044 WP_001217338.1 GMP reductase -
  BW25113_RS00525 (BW25113_0106) pilC/hofC 111009..112211 (-) 1203 WP_000157266.1 protein transport protein HofC Machinery gene
  BW25113_RS00530 (BW25113_0107) pilB/hofB 112201..113586 (-) 1386 WP_001025145.1 type II secretion system protein GspE Machinery gene
  BW25113_RS00535 (BW25113_0108) pilA/ppdD 113596..114036 (-) 441 WP_000360904.1 prepilin peptidase-dependent pilin Machinery gene
  BW25113_RS00545 (BW25113_0109) nadC 114239..115132 (-) 894 WP_001135174.1 carboxylating nicotinate-nucleotide diphosphorylase -
  BW25113_RS00550 (BW25113_0110) ampD 115220..115771 (+) 552 WP_000923721.1 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD -
  BW25113_RS00555 (BW25113_0111) ampE 115768..116622 (+) 855 WP_000172005.1 beta-lactamase regulator AmpE -
  BW25113_RS00560 (BW25113_0112) aroP 116665..118038 (-) 1374 WP_000969915.1 aromatic amino acid transporter AroP -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sxy/tfoX pilA/ppdD positive effect
  sxy/tfoX fimT/comN/ppdA positive effect
  sxy/tfoX comE1/ybaV positive effect
  sxy/tfoX pilN/comB/hofN positive effect
  sxy/tfoX pilO/comC/hofO positive effect
  sxy/tfoX pilB/hofB positive effect
  sxy/tfoX pilD/pppA positive effect
  sxy/tfoX pilP/comD/hofP positive effect
  sxy/tfoX comF/gntX positive effect
  sxy/tfoX rec2/ycaI positive effect
  sxy/tfoX pilM/comA/hofM positive effect
  sxy/tfoX fimU/comO/ppdB positive effect
  sxy/tfoX comP/ygdB positive effect
  sxy/tfoX pilV/comQ/ppdC positive effect
  sxy/tfoX ssb positive effect
  sxy/tfoX mshC/yggT positive effect
  sxy/tfoX pilQ/comE/hofQ positive effect
  sxy/tfoX dprA/smf positive effect
  sxy/tfoX pilT/yggR positive effect
  sxy/tfoX pilC/hofC positive effect
  sxy/tfoX pilB/ycgB positive effect
  sxy/tfoX comM/yifB positive effect

Sequence


Protein


Download         Length: 146 a.a.        Molecular weight: 15621.75 Da        Isoelectric Point: 4.3938

>NTDB_id=1435 BW25113_RS00535 WP_000360904.1 113596..114036(-) (pilA/ppdD) [Escherichia coli BW25113 strain K-12]
MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQTFVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTR
YVSAMSVAKGVVSLTGQESLNGLSVVMTPGWDNANGVTGWTRNCNIQSDSALQQACEDVFRFDDAN

Nucleotide


Download         Length: 441 bp        

>NTDB_id=1435 BW25113_RS00535 WP_000360904.1 113596..114036(-) (pilA/ppdD) [Escherichia coli BW25113 strain K-12]
ATGGACAAGCAACGCGGTTTTACACTTATCGAACTGATGGTGGTTATTGGCATCATTGCCATTTTAAGCGCCATTGGTAT
TCCCGCTTATCAAAACTACCTGCGCAAAGCCGCACTCACCGACATGCTACAAACCTTTGTGCCTTACCGTACCGCCGTAG
AGTTGTGCGCGCTGGAACATGGTGGATTAGATACCTGCGACGGTGGCAGCAATGGCATTCCCTCGCCTACCACCACCCGC
TATGTTTCAGCCATGAGTGTGGCAAAGGGCGTGGTGTCGCTGACCGGGCAAGAAAGTCTCAATGGGCTAAGCGTCGTCAT
GACACCGGGTTGGGATAACGCAAACGGCGTCACCGGCTGGACGCGCAACTGCAATATTCAAAGTGACAGCGCATTGCAGC
AAGCCTGCGAAGATGTCTTCCGCTTTGATGACGCCAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P36647

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilA Haemophilus influenzae 86-028NP

43.089

84.247

0.363


Multiple sequence alignment