Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilO/comC/hofO   Type   Machinery gene
Locus tag   BW25113_RS17580 Genome accession   NZ_CP009273
Coordinates   3514368..3514808 (-) Length   146 a.a.
NCBI ID   WP_001055759.1    Uniprot ID   -
Organism   Escherichia coli BW25113 strain K-12     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3509368..3519808
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BW25113_RS17555 (BW25113_3388) damX 3509379..3510665 (-) 1287 WP_000343215.1 cell division protein DamX -
  BW25113_RS17560 (BW25113_3389) aroB 3510757..3511845 (-) 1089 WP_000439848.1 3-dehydroquinate synthase -
  BW25113_RS17565 (BW25113_3390) aroK 3511902..3512423 (-) 522 WP_000818618.1 shikimate kinase AroK -
  BW25113_RS17570 (BW25113_3391) pilQ/comE/hofQ 3512824..3514062 (-) 1239 WP_000815987.1 DNA uptake porin HofQ Machinery gene
  BW25113_RS17575 (BW25113_3392) pilP/comD/hofP 3513974..3514378 (-) 405 WP_001264141.1 DNA utilization protein HofP Machinery gene
  BW25113_RS17580 (BW25113_3393) pilO/comC/hofO 3514368..3514808 (-) 441 WP_001055759.1 DNA utilization protein HofO Machinery gene
  BW25113_RS17585 (BW25113_3394) pilN/comB/hofN 3514792..3515331 (-) 540 WP_001069315.1 DNA utilization protein HofN Machinery gene
  BW25113_RS17590 (BW25113_3395) pilM/comA/hofM 3515331..3516110 (-) 780 WP_001295166.1 DNA utilization protein HofM Machinery gene
  BW25113_RS17595 (BW25113_3396) mrcA 3516230..3518782 (+) 2553 WP_001336003.1 peptidoglycan glycosyltransferase/peptidoglycan DD-transpeptidase MrcA -
  BW25113_RS17600 (BW25113_3397) nudE 3518948..3519508 (-) 561 WP_000045744.1 ADP compounds hydrolase NudE -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sxy/tfoX pilO/comC/hofO positive effect
  sxy/tfoX fimT/comN/ppdA positive effect
  sxy/tfoX comE1/ybaV positive effect
  sxy/tfoX pilN/comB/hofN positive effect
  sxy/tfoX pilB/hofB positive effect
  sxy/tfoX pilD/pppA positive effect
  sxy/tfoX rec2/ycaI positive effect
  sxy/tfoX pilP/comD/hofP positive effect
  sxy/tfoX comF/gntX positive effect
  sxy/tfoX pilM/comA/hofM positive effect
  sxy/tfoX pilA/ppdD positive effect
  sxy/tfoX fimU/comO/ppdB positive effect
  sxy/tfoX comP/ygdB positive effect
  sxy/tfoX pilV/comQ/ppdC positive effect
  sxy/tfoX ssb positive effect
  sxy/tfoX mshC/yggT positive effect
  sxy/tfoX pilQ/comE/hofQ positive effect
  sxy/tfoX dprA/smf positive effect
  sxy/tfoX pilT/yggR positive effect
  sxy/tfoX pilC/hofC positive effect
  sxy/tfoX pilB/ycgB positive effect
  sxy/tfoX comM/yifB positive effect

Sequence


Protein


Download         Length: 146 a.a.        Molecular weight: 16846.25 Da        Isoelectric Point: 5.8959

>NTDB_id=1431 BW25113_RS17580 WP_001055759.1 3514368..3514808(-) (pilO/comC/hofO) [Escherichia coli BW25113 strain K-12]
MNMFFDWWFATSPRLRQLCWAFWLLMLVTLIFLSSTHHEERDALIRLRASHHQQWAALYRLVDTAPFSEEKTLPFSPLDF
QLSGAQLVSWHPSAQGGELALKTLWEAVPSAFTRLAERNVSVSRFSLSVEGDDLLFTLQLETPHEG

Nucleotide


Download         Length: 441 bp        

>NTDB_id=1431 BW25113_RS17580 WP_001055759.1 3514368..3514808(-) (pilO/comC/hofO) [Escherichia coli BW25113 strain K-12]
ATGAACATGTTCTTTGACTGGTGGTTCGCCACATCACCCCGCCTCCGCCAGCTTTGCTGGGCATTCTGGTTGCTGATGTT
AGTTACGCTCATTTTTCTGTCATCGACACACCATGAAGAGCGCGACGCATTAATTCGACTACGGGCAAGTCATCACCAGC
AGTGGGCCGCACTGTATCGCCTGGTAGACACCGCTCCCTTCAGCGAGGAAAAAACGCTGCCCTTTTCGCCACTGGATTTT
CAGTTATCCGGCGCGCAACTGGTTTCCTGGCATCCATCCGCGCAGGGAGGCGAGTTGGCGTTGAAAACGCTGTGGGAAGC
AGTGCCGTCGGCATTTACACGGCTGGCAGAGCGCAACGTCAGCGTGAGCCGTTTTTCGTTAAGCGTGGAAGGTGATGATC
TTTTGTTCACGCTACAACTGGAGACGCCGCATGAGGGTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value