Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE1/ybaV   Type   Machinery gene
Locus tag   BW25113_RS02290 Genome accession   NZ_CP009273
Coordinates   459393..459764 (+) Length   123 a.a.
NCBI ID   WP_000680312.1    Uniprot ID   B2U4P7
Organism   Escherichia coli BW25113 strain K-12     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 454393..464764
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BW25113_RS02280 (BW25113_0440) hupB 456889..457179 (+) 291 WP_254892905.1 nucleoid-associated protein HU-beta -
  BW25113_RS02285 (BW25113_0441) ppiD 457371..459242 (+) 1872 WP_000969372.1 peptidylprolyl isomerase -
  BW25113_RS02290 (BW25113_0442) comE1/ybaV 459393..459764 (+) 372 WP_000680312.1 helix-hairpin-helix domain-containing protein Machinery gene
  BW25113_RS02295 (BW25113_0443) fadM 459858..460256 (+) 399 WP_001194534.1 long-chain acyl-CoA thioesterase FadM -
  BW25113_RS02300 (BW25113_0444) queC 460308..461003 (-) 696 WP_000817220.1 7-cyano-7-deazaguanine synthase QueC -
  BW25113_RS02305 (BW25113_0445) ybaE 461068..462768 (-) 1701 WP_001238234.1 SgrR family transcriptional regulator -
  BW25113_RS02310 (BW25113_0446) cof 462868..463686 (+) 819 WP_001336137.1 HMP-PP phosphatase -
  BW25113_RS02315 (BW25113_0447) decR 463839..464297 (+) 459 WP_000884589.1 DNA-binding transcriptional regulator DecR -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sxy/tfoX comE1/ybaV positive effect
  sxy/tfoX fimT/comN/ppdA positive effect
  sxy/tfoX pilN/comB/hofN positive effect
  sxy/tfoX pilO/comC/hofO positive effect
  sxy/tfoX pilB/hofB positive effect
  sxy/tfoX pilD/pppA positive effect
  sxy/tfoX pilP/comD/hofP positive effect
  sxy/tfoX comF/gntX positive effect
  sxy/tfoX rec2/ycaI positive effect
  sxy/tfoX pilM/comA/hofM positive effect
  sxy/tfoX pilA/ppdD positive effect
  sxy/tfoX fimU/comO/ppdB positive effect
  sxy/tfoX comP/ygdB positive effect
  sxy/tfoX pilV/comQ/ppdC positive effect
  sxy/tfoX ssb positive effect
  sxy/tfoX mshC/yggT positive effect
  sxy/tfoX pilQ/comE/hofQ positive effect
  sxy/tfoX dprA/smf positive effect
  sxy/tfoX pilT/yggR positive effect
  sxy/tfoX pilC/hofC positive effect
  sxy/tfoX pilB/ycgB positive effect
  sxy/tfoX comM/yifB positive effect

Sequence


Protein


Download         Length: 123 a.a.        Molecular weight: 12703.65 Da        Isoelectric Point: 8.9767

>NTDB_id=1440 BW25113_RS02290 WP_000680312.1 459393..459764(+) (comE1/ybaV) [Escherichia coli BW25113 strain K-12]
MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQSKAAVPAKASDEEGTRVSINNASAEELARAMNGVG
LKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVERNLAVLTL

Nucleotide


Download         Length: 372 bp        

>NTDB_id=1440 BW25113_RS02290 WP_000680312.1 459393..459764(+) (comE1/ybaV) [Escherichia coli BW25113 strain K-12]
ATGAAACACGGAATTAAAGCACTGCTCATTACCCTGTCCCTGGCCTGTGCCGGAATGTCTCATAGCGCGCTGGCGGCAGC
TTCTGTGGCGAAACCGACGGCGGTAGAAACCAAAGCGGAAGCTCCTGCAGCACAAAGTAAAGCAGCAGTACCGGCGAAAG
CCAGTGACGAAGAAGGCACCCGGGTCAGCATTAATAATGCCAGCGCGGAAGAGCTAGCCCGCGCGATGAATGGCGTTGGC
CTGAAGAAAGCGCAGGCGATTGTCAGTTATCGCGAAGAGTACGGTCCGTTTAAAACTGTGGAGGATCTAAAGCAGGTGCC
GGGGATGGGCAATTCGCTGGTGGAACGTAATCTGGCGGTATTAACCCTGTAA

Domains


Predicted by InterProScan.

(59-118)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB B2U4P7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value