Detailed information    

insolico Bioinformatically predicted

Overview


Name   mshC/yggT   Type   Machinery gene
Locus tag   BW25113_RS15330 Genome accession   NZ_CP009273
Coordinates   3089179..3089745 (+) Length   188 a.a.
NCBI ID   WP_001094831.1    Uniprot ID   A0A9P2PPS7
Organism   Escherichia coli BW25113 strain K-12     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3084179..3094745
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BW25113_RS15300 (BW25113_2946) rsmE 3084493..3085224 (+) 732 WP_001222509.1 16S rRNA (uracil(1498)-N(3))-methyltransferase -
  BW25113_RS15305 (BW25113_2947) gshB 3085237..3086187 (+) 951 WP_000593273.1 glutathione synthase -
  BW25113_RS15310 (BW25113_2948) yqgE 3086296..3086859 (+) 564 WP_001053178.1 YqgE/AlgH family protein -
  BW25113_RS15315 (BW25113_2949) ruvX 3086859..3087275 (+) 417 WP_000017106.1 Holliday junction resolvase RuvX -
  BW25113_RS15320 (BW25113_2950) pilT/yggR 3087459..3088439 (-) 981 WP_001326494.1 type IV pilus twitching motility protein PilT Machinery gene
  BW25113_RS15325 (BW25113_2951) yggS 3088457..3089161 (+) 705 WP_000997795.1 pyridoxal phosphate homeostasis protein -
  BW25113_RS15330 (BW25113_2952) mshC/yggT 3089179..3089745 (+) 567 WP_001094831.1 osmotic shock tolerance protein YggT Machinery gene
  BW25113_RS15335 (BW25113_2953) yggU 3089742..3090032 (+) 291 WP_000994920.1 DUF167 family protein YggU -
  BW25113_RS15340 (BW25113_2954) rdgB 3090040..3090633 (+) 594 WP_001174777.1 RdgB/HAM1 family non-canonical purine NTP pyrophosphatase -
  BW25113_RS15345 (BW25113_2955) hemW 3090626..3091762 (+) 1137 WP_000239943.1 radical SAM family heme chaperone HemW -
  BW25113_RS15350 (BW25113_2956) yggM 3091917..3092924 (-) 1008 WP_000745210.1 DUF1202 family protein -
  BW25113_RS15355 (BW25113_2957) ansB 3093041..3094087 (-) 1047 WP_000394140.1 L-asparaginase 2 -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sxy/tfoX mshC/yggT positive effect
  sxy/tfoX fimT/comN/ppdA positive effect
  sxy/tfoX comE1/ybaV positive effect
  sxy/tfoX pilN/comB/hofN positive effect
  sxy/tfoX pilO/comC/hofO positive effect
  sxy/tfoX pilB/hofB positive effect
  sxy/tfoX pilD/pppA positive effect
  sxy/tfoX rec2/ycaI positive effect
  sxy/tfoX pilP/comD/hofP positive effect
  sxy/tfoX comF/gntX positive effect
  sxy/tfoX pilM/comA/hofM positive effect
  sxy/tfoX pilA/ppdD positive effect
  sxy/tfoX fimU/comO/ppdB positive effect
  sxy/tfoX comP/ygdB positive effect
  sxy/tfoX pilV/comQ/ppdC positive effect
  sxy/tfoX ssb positive effect
  sxy/tfoX pilQ/comE/hofQ positive effect
  sxy/tfoX dprA/smf positive effect
  sxy/tfoX pilT/yggR positive effect
  sxy/tfoX pilC/hofC positive effect
  sxy/tfoX pilB/ycgB positive effect
  sxy/tfoX comM/yifB positive effect

Sequence


Protein


Download         Length: 188 a.a.        Molecular weight: 21167.11 Da        Isoelectric Point: 9.8018

>NTDB_id=1449 BW25113_RS15330 WP_001094831.1 3089179..3089745(+) (mshC/yggT) [Escherichia coli BW25113 strain K-12]
MNTLTFLLSTVIELYTMVLLLRIWMQWAHCDFYNPFSQFVVKVTQPIIGPLRRVIPAMGPIDSASLLVAYILSFIKAIVL
FKVVTFLPIIWIAGLLILLKTIGLLIFWVLLVMAIMSWVSQGRSPIEYVLIQLADPLLRPIRRLLPAMGGIDFSPMILVL
LLYVINMGVAEVLQATGNMLLPGLWMAL

Nucleotide


Download         Length: 567 bp        

>NTDB_id=1449 BW25113_RS15330 WP_001094831.1 3089179..3089745(+) (mshC/yggT) [Escherichia coli BW25113 strain K-12]
ATGAATACGTTGACTTTCCTGCTTTCAACGGTCATTGAGCTGTATACCATGGTGCTGTTATTACGCATCTGGATGCAGTG
GGCTCATTGTGATTTTTACAACCCCTTCTCACAGTTTGTAGTGAAGGTAACGCAGCCAATTATCGGGCCACTGCGCCGCG
TTATTCCGGCAATGGGGCCAATTGACAGCGCCTCGCTGCTGGTTGCCTATATTCTCAGTTTTATCAAAGCCATCGTGCTG
TTTAAAGTGGTGACCTTCCTGCCAATCATCTGGATTGCCGGTTTACTGATTCTGCTGAAAACCATCGGCCTGCTGATTTT
CTGGGTCCTGCTGGTGATGGCGATTATGAGCTGGGTAAGCCAGGGGCGTAGCCCGATTGAATACGTGCTGATTCAGCTGG
CCGATCCGCTGCTGCGCCCGATTCGCCGCCTGCTACCGGCAATGGGTGGGATTGATTTCTCGCCGATGATCCTCGTTCTG
CTGCTGTATGTCATCAATATGGGTGTCGCAGAAGTATTACAGGCAACCGGAAATATGCTGCTGCCAGGGCTGTGGATGGC
GTTATGA

Domains


Predicted by InterProScan.

(10-78)

(105-167)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value