Detailed information    

insolico Bioinformatically predicted

Overview


Name   fimT/comN/ppdA   Type   Machinery gene
Locus tag   BW25113_RS14695 Genome accession   NZ_CP009273
Coordinates   2957066..2957536 (-) Length   156 a.a.
NCBI ID   WP_000857051.1    Uniprot ID   Q32C95
Organism   Escherichia coli BW25113 strain K-12     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2952066..2962536
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BW25113_RS14675 (BW25113_2822) recC 2952419..2955787 (-) 3369 WP_000946938.1 exodeoxyribonuclease V subunit gamma -
  BW25113_RS14680 (BW25113_2823) pilV/comQ/ppdC 2955800..2956123 (-) 324 WP_001276460.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  BW25113_RS14685 (BW25113_2824) comP/ygdB 2956108..2956515 (-) 408 WP_001078376.1 DUF2509 family protein Machinery gene
  BW25113_RS14690 (BW25113_2825) fimU/comO/ppdB 2956512..2957075 (-) 564 WP_001144315.1 prepilin peptidase-dependent protein Machinery gene
  BW25113_RS14695 (BW25113_2826) fimT/comN/ppdA 2957066..2957536 (-) 471 WP_000857051.1 prepilin peptidase-dependent protein Machinery gene
  BW25113_RS14700 (BW25113_2827) thyA 2957720..2958514 (-) 795 WP_000816232.1 thymidylate synthase -
  BW25113_RS14705 (BW25113_2828) lgt 2958521..2959396 (-) 876 WP_000204658.1 prolipoprotein diacylglyceryl transferase -
  BW25113_RS14710 (BW25113_2829) ptsP 2959547..2961793 (-) 2247 WP_000957910.1 phosphoenolpyruvate--protein phosphotransferase -
  BW25113_RS14715 (BW25113_2830) rppH 2961806..2962336 (-) 531 WP_000564489.1 RNA pyrophosphohydrolase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sxy/tfoX fimT/comN/ppdA positive effect
  sxy/tfoX comE1/ybaV positive effect
  sxy/tfoX pilN/comB/hofN positive effect
  sxy/tfoX pilO/comC/hofO positive effect
  sxy/tfoX pilB/hofB positive effect
  sxy/tfoX pilD/pppA positive effect
  sxy/tfoX pilP/comD/hofP positive effect
  sxy/tfoX comF/gntX positive effect
  sxy/tfoX rec2/ycaI positive effect
  sxy/tfoX pilM/comA/hofM positive effect
  sxy/tfoX pilA/ppdD positive effect
  sxy/tfoX fimU/comO/ppdB positive effect
  sxy/tfoX comP/ygdB positive effect
  sxy/tfoX pilV/comQ/ppdC positive effect
  sxy/tfoX ssb positive effect
  sxy/tfoX mshC/yggT positive effect
  sxy/tfoX pilQ/comE/hofQ positive effect
  sxy/tfoX dprA/smf positive effect
  sxy/tfoX pilT/yggR positive effect
  sxy/tfoX pilC/hofC positive effect
  sxy/tfoX pilB/ycgB positive effect
  sxy/tfoX comM/yifB positive effect

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17865.41 Da        Isoelectric Point: 7.7262

>NTDB_id=1441 BW25113_RS14695 WP_000857051.1 2957066..2957536(-) (fimT/comN/ppdA) [Escherichia coli BW25113 strain K-12]
MKTQRGYTLIETLVAMLILVMLSASGLYGWQYWQQSQRLWQTASQARDYLLYLREDANWHNRDHSISVIREGTLWCLVSS
AAGANTCHGSSPLVFVPRWPEVEMSDLTPSLAFFGLRNTAWAGHIRFKNSTGEWWLVVSPWGRLRLCQQGETEGCL

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1441 BW25113_RS14695 WP_000857051.1 2957066..2957536(-) (fimT/comN/ppdA) [Escherichia coli BW25113 strain K-12]
ATGAAAACACAACGTGGTTATACGCTGATTGAAACGCTGGTCGCGATGCTGATTTTGGTCATGCTAAGCGCAAGTGGACT
CTATGGCTGGCAATACTGGCAGCAGTCGCAACGGCTATGGCAAACCGCCAGCCAGGCGCGGGACTATTTGCTCTATTTAC
GTGAAGATGCCAACTGGCATAACCGCGACCACAGTATCAGCGTTATCAGGGAGGGGACGTTATGGTGCCTTGTGAGTTCC
GCTGCTGGGGCCAATACCTGTCATGGCAGTTCACCATTGGTCTTTGTGCCACGCTGGCCCGAAGTCGAAATGAGCGACCT
GACACCTTCGCTTGCTTTCTTTGGCCTGCGCAATACCGCATGGGCCGGGCATATTCGCTTCAAAAACTCAACGGGCGAGT
GGTGGCTGGTGGTTTCGCCGTGGGGAAGACTCCGGCTTTGTCAGCAAGGAGAAACAGAAGGATGCCTGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q32C95

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value