Detailed information NTG1145209

Bioinformatically predicted

Overview

• Name: comA
• Type: Machinery gene
• Locus tag: DXE35_RS10080
• Genome accession: NZ_LT606949
• Coordinates: 423758..423868 (+)
• Length: 36 a.a.
• NCBI ID: WP_331851951.1
• Uniprot ID: -
• Organism: Polynucleobacter necessarius isolate PPGSP7
• Function: DNA uptake (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	416343..429528	423758..423868	within	0

Gene organization within MGE regions

Location: 416343..429528

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DXE35_RS02400	recJ	417466..419241 (-)	1776	WP_114689454.1	single-stranded-DNA-specific exonuclease RecJ	-
DXE35_RS02405	-	419249..420208 (-)	960	WP_231969929.1	hypothetical protein	-
DXE35_RS02410	-	420276..421538 (+)	1263	WP_114689456.1	lipoprotein-releasing ABC transporter permease subunit	-
DXE35_RS02415	-	421531..422238 (+)	708	WP_114689457.1	ABC transporter ATP-binding protein	-
DXE35_RS02420	-	422250..423086 (+)	837	WP_114690354.1	TatD family hydrolase	-
DXE35_RS02425	-	423206..423727 (+)	522	WP_269459848.1	ComEC/Rec2 family competence protein	-
DXE35_RS10080	comA	423758..423868 (+)	111	WP_331851951.1	MBL fold metallo-hydrolase	Machinery gene
DXE35_RS02430	-	423865..424251 (+)	387	WP_114689458.1	recombinase family protein	-
DXE35_RS02435	-	424309..424923 (+)	615	WP_114689459.1	recombinase family protein	-
DXE35_RS02440	-	424933..425316 (+)	384	WP_162784943.1	hypothetical protein	-
DXE35_RS02450	-	425778..427618 (+)	1841	Protein_505	potassium transporter Kup	-
DXE35_RS02455	-	427678..428124 (+)	447	WP_231969932.1	hypothetical protein	-
DXE35_RS02460	radA	428164..429528 (+)	1365	WP_114689462.1	DNA repair protein RadA	Machinery gene

Sequence

Protein

• Length: 36 a.a.
• Molecular weight: 3958.53 Da
• Isoelectric Point: 8.8582

>NTDB_id=1145209 DXE35_RS10080 WP_331851951.1 423758..423868(+) (comA) [Polynucleobacter necessarius isolate PPGSP7]
MLPYLRGRGINQIDRMVISHSDSDHVGGAATLLRHA

Nucleotide

• Length: 111 bp

>NTDB_id=1145209 DXE35_RS10080 WP_331851951.1 423758..423868(+) (comA) [Polynucleobacter necessarius isolate PPGSP7]
ATCTTGCCGTATTTGCGTGGCAGAGGTATTAACCAAATCGATCGCATGGTGATTAGTCACAGCGATAGTGATCACGTTGG
TGGTGCTGCAACATTGCTAAGGCATGCATGA

Domains

Predicted by InterproScan.

• Metallo-beta-lactamase superfamily (Lactamase_B) (3-35)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comA	Ralstonia pseudosolanacearum GMI1000	54.545	91.667	0.5
rec2	Haemophilus influenzae Rd KW20	47.059	94.444	0.444
comA	Pseudomonas stutzeri DSM 10701	47.059	94.444	0.444
comEC	Vibrio campbellii strain DS40M4	48.485	91.667	0.444
comEC	Legionella pneumophila strain ERS1305867	50	88.889	0.444
comEC	Legionella pneumophila strain Lp02	50	88.889	0.444
comEC	Bacillus subtilis subsp. subtilis str. 168	42.857	97.222	0.417
comEC	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	41.176	94.444	0.389
comA/comEC	Acinetobacter baumannii strain A118	46.429	77.778	0.361
comA/comEC	Acinetobacter baumannii D1279779	46.429	77.778	0.361
comA	Neisseria gonorrhoeae MS11	46.429	77.778	0.361
comEC	Vibrio parahaemolyticus RIMD 2210633	50	72.222	0.361
comEC	Lactococcus lactis subsp. cremoris KW2	40.625	88.889	0.361
comEC	Legionella pneumophila str. Paris	40.625	88.889	0.361
comA/comEC	Acinetobacter baylyi ADP1	38.235	94.444	0.361