Detailed information NTG1144890

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLA12_RS11735
• Genome accession: NZ_LT599049
• Coordinates: 2382501..2382884 (-)
• Length: 127 a.a.
• NCBI ID: WP_080651958.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain A12
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2377501..2387884

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLA12_RS11695 (LLA12_02480)	-	2378036..2378845 (-)	810	WP_032946979.1	metal ABC transporter permease	-
LLA12_RS11700 (LLA12_02481)	-	2378838..2379575 (-)	738	WP_021723055.1	metal ABC transporter ATP-binding protein	-
LLA12_RS11705 (LLA12_02482)	-	2379753..2380595 (-)	843	WP_068872849.1	metal ABC transporter substrate-binding protein	-
LLA12_RS11710 (LLA12_02483)	-	2380592..2381029 (-)	438	WP_021721874.1	zinc-dependent MarR family transcriptional regulator	-
LLA12_RS11715 (LLA12_02484)	comGG	2381110..2381385 (-)	276	WP_021721873.1	hypothetical protein	Machinery gene
LLA12_RS11720 (LLA12_02485)	comGF	2381433..2381879 (-)	447	WP_021721872.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLA12_RS11725 (LLA12_02486)	comGE	2381842..2382138 (-)	297	WP_021721871.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLA12_RS11730 (LLA12_02487)	comGD	2382110..2382541 (-)	432	WP_080651959.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLA12_RS11735 (LLA12_02488)	comGC	2382501..2382884 (-)	384	WP_080651958.1	competence type IV pilus major pilin ComGC	Machinery gene
LLA12_RS11740 (LLA12_02489)	comGB	2382898..2383971 (-)	1074	WP_080651957.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLA12_RS11745 (LLA12_02490)	comGA	2383865..2384803 (-)	939	WP_032946550.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 127 a.a.
• Molecular weight: 14811.42 Da
• Isoelectric Point: 8.4538

>NTDB_id=1144890 LLA12_RS11735 WP_080651958.1 2382501..2382884(-) (comGC) [Lactococcus lactis subsp. lactis strain A12]
MERTKKFILKKIQKIFLFVKICEKKCRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA
QLYELDHDDEKPTLSELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

• Length: 384 bp

>NTDB_id=1144890 LLA12_RS11735 WP_080651958.1 2382501..2382884(-) (comGC) [Lactococcus lactis subsp. lactis strain A12]
ATGGAAAGAACAAAGAAGTTTATTTTAAAGAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG
TCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG
TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCT
CAACTTTATGAATTAGATCATGATGATGAGAAGCCGACTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACA
AATTTCTGCTTACGATAATTACTATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (32-52)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	81.034	91.339	0.74
comYC	Streptococcus mutans UA159	56.436	79.528	0.449
comYC	Streptococcus mutans UA140	56.436	79.528	0.449
comYC	Streptococcus gordonii str. Challis substr. CH1	57.576	77.953	0.449
comGC/cglC	Streptococcus mitis SK321	55.446	79.528	0.441
comGC/cglC	Streptococcus pneumoniae TIGR4	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae D39	53.465	79.528	0.425
comGC/cglC	Streptococcus pneumoniae R6	53.465	79.528	0.425
comYC	Streptococcus suis isolate S10	57.955	69.291	0.402
comGC/cglC	Streptococcus mitis NCTC 12261	57.303	70.079	0.402