Detailed information NTG1132097

Bioinformatically predicted

Overview

• Name: comX
• Type: Regulator
• Locus tag: H1W86_RS00860
• Genome accession: NZ_LR822042
• Coordinates: 146776..147273 (+)
• Length: 165 a.a.
• NCBI ID: WP_002949220.1
• Uniprot ID: A0A0M4HKA9
• Organism: Streptococcus thermophilus isolate STH_CIRM_1358
• Function: activation of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	141768..146021	146776..147273	flank	755

Gene organization within MGE regions

Location: 141768..147273

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H1W86_RS00825 (STHERMO_0135)	-	141775..142589 (-)	815	Protein_112	ISL3 family transposase	-
H1W86_RS00830 (STHERMO_0136)	-	142882..143103 (+)	222	WP_002948904.1	DUF4649 family protein	-
H1W86_RS00835	-	143188..143510 (-)	323	Protein_114	transposase	-
H1W86_RS00840 (STHERMO_0138)	-	143699..144025 (+)	327	WP_014607875.1	M20/M25/M40 family metallo-hydrolase	-
H1W86_RS00845 (STHERMO_0140)	-	144107..145297 (+)	1191	Protein_116	class I SAM-dependent methyltransferase	-
H1W86_RS00850 (STHERMO_0141)	-	145557..146021 (-)	465	Protein_117	transposase family protein	-
H1W86_RS00855	-	146380..146484 (+)	105	Protein_118	IS200/IS605 family transposase	-
H1W86_RS00860 (STHERMO_0142)	comX	146776..147273 (+)	498	WP_002949220.1	sigma factor	Regulator

Sequence

Protein

• Length: 165 a.a.
• Molecular weight: 20160.12 Da
• Isoelectric Point: 5.2073

>NTDB_id=1132097 H1W86_RS00860 WP_002949220.1 146776..147273(+) (comX) [Streptococcus thermophilus isolate STH_CIRM_1358]
MEQEVFVKAYEKVRPIVLKAFRQYFIQLWDQADMEQEAMMTLYQLLKKFPDLEKDDDKLRRYFKTKFRNRLNDEVRRQES
VKRQANRQCYVEISDIAFCIPNKELDMVDRLAYDEQLNAFREQLSSEDSLKLDRLLGGECFRGRKKMIRELRFWMVDFDP
CNEED

Nucleotide

• Length: 498 bp

>NTDB_id=1132097 H1W86_RS00860 WP_002949220.1 146776..147273(+) (comX) [Streptococcus thermophilus isolate STH_CIRM_1358]
ATGGAACAAGAAGTTTTTGTTAAGGCATATGAAAAGGTAAGGCCAATTGTACTTAAGGCGTTTAGGCAATACTTTATTCA
GCTTTGGGATCAAGCTGACATGGAGCAAGAGGCGATGATGACTTTGTATCAGCTTTTAAAAAAGTTTCCTGATTTAGAGA
AAGATGATGATAAGTTACGTCGTTACTTTAAAACTAAGTTTAGGAATCGACTTAATGATGAAGTGAGGCGGCAGGAGTCA
GTAAAACGTCAAGCTAATAGACAGTGTTATGTTGAAATTTCAGATATTGCCTTTTGTATTCCCAATAAGGAGCTAGATAT
GGTTGATAGACTTGCTTATGATGAACAGCTTAATGCTTTTCGTGAGCAGTTATCATCGGAAGATTCTCTTAAGTTGGATC
GATTGTTGGGTGGTGAATGCTTTAGGGGAAGGAAAAAGATGATACGAGAGTTAAGATTTTGGATGGTTGACTTTGATCCA
TGTAATGAAGAAGACTGA

Domains

Predicted by InterproScan.

• Sigma-70 region 2 (Sigma70_r2) (10-79)

3D structure

• AlphaFold DB: A0A0M4HKA9

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX	Streptococcus thermophilus LMD-9	100	100	1
comX	Streptococcus thermophilus LMG 18311	100	100	1
comX/sigX	Streptococcus salivarius strain HSISS4	89.091	100	0.891
comX	Streptococcus salivarius SK126	88.485	100	0.885
comX	Streptococcus sobrinus strain NIDR 6715-7	41.975	98.182	0.412
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	41.667	94.545	0.394
comX/sigX	Streptococcus mutans UA159	41.026	94.545	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX	Streptococcus suis D9	40.523	92.727	0.376
comX/sigX	Streptococcus suis isolate S10	40.523	92.727	0.376
comX/sigX	Streptococcus suis P1/7	40.523	92.727	0.376