Detailed information NTG1131862

Bioinformatically predicted

Overview

• Name: comX
• Type: Regulator
• Locus tag: H1W87_RS00840
• Genome accession: NZ_LR822037
• Coordinates: 143544..144041 (+)
• Length: 165 a.a.
• NCBI ID: WP_002949220.1
• Uniprot ID: A0A0M4HKA9
• Organism: Streptococcus thermophilus isolate STH_CIRM_1121
• Function: activation of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	138495..142790	143544..144041	flank	754

Gene organization within MGE regions

Location: 138495..144041

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H1W87_RS00805 (STHERMO_0140)	-	138502..139316 (-)	815	Protein_105	ISL3 family transposase	-
H1W87_RS00810 (STHERMO_0141)	-	139609..139830 (+)	222	WP_002948904.1	DUF4649 family protein	-
H1W87_RS00815	-	139915..140237 (-)	323	Protein_107	transposase	-
H1W87_RS00820 (STHERMO_0144)	-	140426..140752 (+)	327	WP_082302972.1	M20/M25/M40 family metallo-hydrolase	-
H1W87_RS00825 (STHERMO_0145)	-	140876..142066 (+)	1191	WP_002949216.1	SAM-dependent methyltransferase	-
H1W87_RS00830 (STHERMO_0146)	-	142326..142790 (-)	465	Protein_110	transposase family protein	-
H1W87_RS00835	-	143148..143252 (+)	105	Protein_111	IS200/IS605 family transposase	-
H1W87_RS00840 (STHERMO_0147)	comX	143544..144041 (+)	498	WP_002949220.1	sigma factor	Regulator

Sequence

Protein

• Length: 165 a.a.
• Molecular weight: 20160.12 Da
• Isoelectric Point: 5.2073

>NTDB_id=1131862 H1W87_RS00840 WP_002949220.1 143544..144041(+) (comX) [Streptococcus thermophilus isolate STH_CIRM_1121]
MEQEVFVKAYEKVRPIVLKAFRQYFIQLWDQADMEQEAMMTLYQLLKKFPDLEKDDDKLRRYFKTKFRNRLNDEVRRQES
VKRQANRQCYVEISDIAFCIPNKELDMVDRLAYDEQLNAFREQLSSEDSLKLDRLLGGECFRGRKKMIRELRFWMVDFDP
CNEED

Nucleotide

• Length: 498 bp

>NTDB_id=1131862 H1W87_RS00840 WP_002949220.1 143544..144041(+) (comX) [Streptococcus thermophilus isolate STH_CIRM_1121]
ATGGAACAAGAAGTTTTTGTTAAGGCATATGAAAAGGTAAGGCCAATTGTACTTAAGGCTTTTAGGCAATACTTTATTCA
GCTTTGGGATCAAGCTGACATGGAGCAAGAGGCGATGATGACTTTGTATCAGCTTTTAAAAAAGTTTCCTGATTTAGAGA
AAGATGATGATAAGTTACGTCGTTACTTTAAAACTAAGTTTAGGAATCGACTTAATGATGAAGTGAGGCGGCAGGAGTCA
GTAAAACGTCAAGCTAATAGACAGTGCTATGTTGAAATTTCAGATATTGCCTTTTGTATTCCCAATAAGGAGCTAGATAT
GGTTGATAGACTTGCTTATGATGAACAGCTTAATGCTTTTCGTGAGCAGTTATCATCGGAAGATTCTCTTAAGTTGGATC
GATTGTTGGGTGGTGAATGCTTTAGGGGAAGGAAAAAGATGATACGAGAGTTAAGATTTTGGATGGTTGACTTTGATCCA
TGTAATGAAGAAGACTGA

Domains

Predicted by InterproScan.

• Sigma-70 region 2 (Sigma70_r2) (10-79)

3D structure

• AlphaFold DB: A0A0M4HKA9

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX	Streptococcus thermophilus LMD-9	100	100	1
comX	Streptococcus thermophilus LMG 18311	100	100	1
comX/sigX	Streptococcus salivarius strain HSISS4	89.091	100	0.891
comX	Streptococcus salivarius SK126	88.485	100	0.885
comX	Streptococcus sobrinus strain NIDR 6715-7	41.975	98.182	0.412
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	41.667	94.545	0.394
comX/sigX	Streptococcus mutans UA159	41.026	94.545	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX	Streptococcus suis D9	40.523	92.727	0.376
comX/sigX	Streptococcus suis isolate S10	40.523	92.727	0.376
comX/sigX	Streptococcus suis P1/7	40.523	92.727	0.376