Detailed information NTG1130709

Bioinformatically predicted

Overview

• Name: comX
• Type: Regulator
• Locus tag: H0505_RS00835
• Genome accession: NZ_LR822012
• Coordinates: 145508..146005 (+)
• Length: 165 a.a.
• NCBI ID: WP_002949220.1
• Uniprot ID: A0A0M4HKA9
• Organism: Streptococcus thermophilus isolate STH_CIRM_30
• Function: activation of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	141344..144755	145508..146005	flank	753

Gene organization within MGE regions

Location: 141344..146005

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H0505_RS00810 (STHERMO_0137)	-	141375..142189 (-)	815	Protein_109	ISL3 family transposase	-
H0505_RS00815 (STHERMO_0139)	-	142431..142757 (+)	327	WP_014607875.1	M20/M25/M40 family metallo-hydrolase	-
H0505_RS00820 (STHERMO_0140)	-	142839..144029 (+)	1191	WP_179971138.1	SAM-dependent methyltransferase	-
H0505_RS00825 (STHERMO_0142)	-	144290..144755 (-)	466	Protein_112	transposase family protein	-
H0505_RS00830	-	145112..145216 (+)	105	Protein_113	IS200/IS605 family transposase	-
H0505_RS00835 (STHERMO_0143)	comX	145508..146005 (+)	498	WP_002949220.1	sigma factor	Regulator

Sequence

Protein

• Length: 165 a.a.
• Molecular weight: 20160.12 Da
• Isoelectric Point: 5.2073

>NTDB_id=1130709 H0505_RS00835 WP_002949220.1 145508..146005(+) (comX) [Streptococcus thermophilus isolate STH_CIRM_30]
MEQEVFVKAYEKVRPIVLKAFRQYFIQLWDQADMEQEAMMTLYQLLKKFPDLEKDDDKLRRYFKTKFRNRLNDEVRRQES
VKRQANRQCYVEISDIAFCIPNKELDMVDRLAYDEQLNAFREQLSSEDSLKLDRLLGGECFRGRKKMIRELRFWMVDFDP
CNEED

Nucleotide

• Length: 498 bp

>NTDB_id=1130709 H0505_RS00835 WP_002949220.1 145508..146005(+) (comX) [Streptococcus thermophilus isolate STH_CIRM_30]
ATGGAACAAGAAGTTTTTGTTAAGGCATATGAAAAGGTAAGGCCAATTGTACTTAAGGCTTTTAGGCAATACTTTATTCA
GCTTTGGGATCAAGCTGACATGGAGCAAGAGGCGATGATGACTTTGTATCAGCTTTTAAAAAAGTTTCCTGATTTAGAGA
AAGATGATGATAAGTTACGTCGTTACTTTAAAACTAAGTTTAGGAATCGACTTAATGATGAAGTGAGGCGGCAGGAGTCA
GTAAAACGTCAAGCTAATAGACAGTGCTATGTTGAAATTTCAGATATTGCCTTTTGTATTCCCAATAAGGAGCTAGATAT
GGTTGATAGACTTGCTTATGATGAACAGCTTAATGCTTTTCGTGAGCAGTTATCATCGGAAGATTCTCTTAAGTTGGATC
GATTGTTGGGTGGTGAATGCTTTAGGGGAAGGAAAAAGATGATACGAGAGTTAAGATTTTGGATGGTTGACTTTGATCCA
TGTAATGAAGAAGACTGA

Domains

Predicted by InterproScan.

• Sigma-70 region 2 (Sigma70_r2) (10-79)

3D structure

• AlphaFold DB: A0A0M4HKA9

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX	Streptococcus thermophilus LMD-9	100	100	1
comX	Streptococcus thermophilus LMG 18311	100	100	1
comX/sigX	Streptococcus salivarius strain HSISS4	89.091	100	0.891
comX	Streptococcus salivarius SK126	88.485	100	0.885
comX	Streptococcus sobrinus strain NIDR 6715-7	41.975	98.182	0.412
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	42.581	93.939	0.4
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	41.667	94.545	0.394
comX/sigX	Streptococcus mutans UA159	41.026	94.545	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	42.667	90.909	0.388
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	42.667	90.909	0.388
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	42	90.909	0.382
comX/sigX	Streptococcus suis D9	40.523	92.727	0.376
comX/sigX	Streptococcus suis isolate S10	40.523	92.727	0.376
comX/sigX	Streptococcus suis P1/7	40.523	92.727	0.376