Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | ACAM21_RS10070 | Genome accession | NZ_AP031395 |
| Coordinates | 1918215..1918541 (-) | Length | 108 a.a. |
| NCBI ID | WP_000738624.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 16P29 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1913215..1923541
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACAM21_RS10025 (SPNE16P29_19490) | rnpA | 1913239..1913610 (-) | 372 | WP_000739246.1 | ribonuclease P protein component | - |
| ACAM21_RS10030 | - | 1913627..1913758 (-) | 132 | WP_000768903.1 | hypothetical protein | - |
| ACAM21_RS10035 (SPNE16P29_19500) | - | 1913759..1914949 (-) | 1191 | WP_000167759.1 | acetate kinase | - |
| ACAM21_RS10040 (SPNE16P29_19510) | comYH | 1915000..1915953 (-) | 954 | WP_000345123.1 | class I SAM-dependent methyltransferase | Machinery gene |
| ACAM21_RS10045 (SPNE16P29_19520) | - | 1916014..1916601 (-) | 588 | WP_000679774.1 | class I SAM-dependent methyltransferase | - |
| ACAM21_RS10050 (SPNE16P29_19530) | comGG/cglG | 1916738..1917151 (-) | 414 | WP_000265630.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACAM21_RS10055 (SPNE16P29_19540) | comGF/cglF | 1917129..1917590 (-) | 462 | WP_000250548.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACAM21_RS10060 (SPNE16P29_19550) | comGE/cglE | 1917553..1917855 (-) | 303 | WP_000413380.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACAM21_RS10065 (SPNE16P29_19560) | comGD/cglD | 1917818..1918222 (-) | 405 | WP_000588007.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACAM21_RS10070 (SPNE16P29_19570) | comGC/cglC | 1918215..1918541 (-) | 327 | WP_000738624.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACAM21_RS10075 (SPNE16P29_19580) | comGB/cglB | 1918543..1919559 (-) | 1017 | WP_073177425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACAM21_RS10080 (SPNE16P29_19590) | comGA/cglA/cilD | 1919507..1920448 (-) | 942 | WP_000249559.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACAM21_RS10085 (SPNE16P29_19600) | - | 1920524..1920889 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| ACAM21_RS10090 (SPNE16P29_19610) | - | 1921156..1922411 (+) | 1256 | WP_088804233.1 | ISL3 family transposase | - |
| ACAM21_RS10095 (SPNE16P29_19620) | - | 1922460..1923518 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12227.44 Da Isoelectric Point: 9.9664
>NTDB_id=109081 ACAM21_RS10070 WP_000738624.1 1918215..1918541(-) (comGC/cglC) [Streptococcus pneumoniae strain 16P29]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLAKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKE
DGRITEEQAKAYKEYNDKNVGANRKVYD
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLAKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKE
DGRITEEQAKAYKEYNDKNVGANRKVYD
Nucleotide
Download Length: 327 bp
>NTDB_id=109081 ACAM21_RS10070 WP_000738624.1 1918215..1918541(-) (comGC/cglC) [Streptococcus pneumoniae strain 16P29]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGGCCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGCAAGTTAAAAGAA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGTAGGAGCAAATCGTAAAGTCTA
TGATTAA
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGGCCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGCAAGTTAAAAGAA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGTAGGAGCAAATCGTAAAGTCTA
TGATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
94.444 |
100 |
0.944 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
93.519 |
100 |
0.935 |
| comGC/cglC | Streptococcus pneumoniae D39 |
93.519 |
100 |
0.935 |
| comGC/cglC | Streptococcus pneumoniae R6 |
93.519 |
100 |
0.935 |
| comGC/cglC | Streptococcus mitis SK321 |
90.741 |
100 |
0.907 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.857 |
90.741 |
0.843 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
70.833 |
88.889 |
0.63 |
| comYC | Streptococcus mutans UA159 |
61.765 |
94.444 |
0.583 |
| comYC | Streptococcus mutans UA140 |
61.765 |
94.444 |
0.583 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
54.902 |
94.444 |
0.519 |
| comYC | Streptococcus suis isolate S10 |
67.901 |
75 |
0.509 |
| comGC | Staphylococcus aureus MW2 |
50 |
79.63 |
0.398 |
| comGC | Staphylococcus aureus N315 |
50 |
79.63 |
0.398 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.349 |
79.63 |
0.361 |