Detailed information NTG1080047

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ACKWPP_RS00760
• Genome accession: NZ_CP176418
• Coordinates: 121205..121486 (+)
• Length: 93 a.a.
• NCBI ID: WP_044680148.1
• Uniprot ID: -
• Organism: Streptococcus suis strain KKAHC02
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 116205..126486

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACKWPP_RS00740 (ACKWPP_00740)	-	117868..118233 (+)	366	WP_409374001.1	DUF1033 family protein	-
ACKWPP_RS00745 (ACKWPP_00745)	-	118268..119218 (-)	951	WP_409374002.1	S66 peptidase family protein	-
ACKWPP_RS00750 (ACKWPP_00750)	comYA	119304..120254 (+)	951	WP_023369082.1	competence type IV pilus ATPase ComGA	Machinery gene
ACKWPP_RS00755 (ACKWPP_00755)	comYB	120166..121203 (+)	1038	WP_044680150.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACKWPP_RS00760 (ACKWPP_00760)	comYC	121205..121486 (+)	282	WP_044680148.1	competence type IV pilus major pilin ComGC	Machinery gene
ACKWPP_RS00765 (ACKWPP_00765)	comGD	121467..121874 (+)	408	WP_044762031.1	competence type IV pilus minor pilin ComGD	-
ACKWPP_RS00770 (ACKWPP_00770)	comYE	121846..122139 (+)	294	WP_024385126.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACKWPP_RS00775 (ACKWPP_00775)	comGF/cglF	122126..122560 (+)	435	WP_074414675.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACKWPP_RS00780 (ACKWPP_00780)	comGG	122538..122948 (+)	411	WP_409374003.1	competence type IV pilus minor pilin ComGG	-
ACKWPP_RS00785 (ACKWPP_00785)	comYH	123005..123958 (+)	954	WP_002936545.1	class I SAM-dependent methyltransferase	Machinery gene
ACKWPP_RS00790 (ACKWPP_00790)	-	124008..125195 (+)	1188	WP_014637319.1	acetate kinase	-
ACKWPP_RS00795 (ACKWPP_00795)	-	125510..126061 (+)	552	WP_141587968.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10408.30 Da
• Isoelectric Point: 5.8596

>NTDB_id=1080047 ACKWPP_RS00760 WP_044680148.1 121205..121486(+) (comYC) [Streptococcus suis strain KKAHC02]
MKKLIEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAVQEKGNAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=1080047 ACKWPP_RS00760 WP_044680148.1 121205..121486(+) (comYC) [Streptococcus suis strain KKAHC02]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCCTTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTGTTCAAGAGAAAGGAAATGCTGCCGTTGTCAAAGTAG
TAGAGAGTCAGATGGAGCTCTATGAATTGGAACATGATGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGTTATATT
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	95.699	100	0.957
comGC/cglC	Streptococcus pneumoniae TIGR4	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae Rx1	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae D39	66.304	98.925	0.656
comGC/cglC	Streptococcus pneumoniae R6	66.304	98.925	0.656
comGC/cglC	Streptococcus mitis NCTC 12261	66.304	98.925	0.656
comGC/cglC	Streptococcus mitis SK321	66.304	98.925	0.656
comYC	Streptococcus gordonii str. Challis substr. CH1	64.045	95.699	0.613
comYC	Streptococcus mutans UA140	61.364	94.624	0.581
comYC	Streptococcus mutans UA159	61.364	94.624	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus MW2	48.718	83.871	0.409
comGC	Staphylococcus aureus N315	48.718	83.871	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	80.645	0.376