Detailed information NTG1067420

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: ACHFB9_RS13835
• Genome accession: NZ_CP172404
• Coordinates: 2985715..2986131 (-)
• Length: 138 a.a.
• NCBI ID: WP_417067896.1
• Uniprot ID: -
• Organism: Niveibacterium terrae strain 24SJ04S-2
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	2973565..2985652	2985715..2986131	flank	63

Gene organization within MGE regions

Location: 2973565..2986131

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACHFB9_RS13790 (ACHFB9_13790)	-	2973565..2975574 (+)	2010	WP_417067885.1	acyltransferase family protein	-
ACHFB9_RS13795 (ACHFB9_13795)	-	2975679..2976461 (+)	783	WP_417067886.1	TylF/MycF/NovP-related O-methyltransferase	-
ACHFB9_RS13800 (ACHFB9_13800)	-	2976482..2977618 (-)	1137	WP_417067887.1	glycosyltransferase family 4 protein	-
ACHFB9_RS13805 (ACHFB9_13805)	-	2977623..2978759 (-)	1137	WP_417067888.1	glycosyltransferase family 4 protein	-
ACHFB9_RS13810 (ACHFB9_13810)	asnB	2978772..2980634 (-)	1863	WP_417067889.1	asparagine synthase (glutamine-hydrolyzing)	-
ACHFB9_RS13815 (ACHFB9_13815)	-	2980753..2981520 (-)	768	WP_417067891.1	class I SAM-dependent methyltransferase	-
ACHFB9_RS13820 (ACHFB9_13820)	-	2981513..2982778 (-)	1266	WP_417067893.1	oligosaccharide flippase family protein	-
ACHFB9_RS13825 (ACHFB9_13825)	-	2982826..2983677 (-)	852	WP_417067894.1	glycosyltransferase family 2 protein	-
ACHFB9_RS13830 (ACHFB9_13830)	-	2983670..2985652 (-)	1983	WP_417067895.1	hypothetical protein	-
ACHFB9_RS13835 (ACHFB9_13835)	pilE	2985715..2986131 (-)	417	WP_417067896.1	pilin	Machinery gene

Sequence

Protein

• Length: 138 a.a.
• Molecular weight: 14239.37 Da
• Isoelectric Point: 9.8086

>NTDB_id=1067420 ACHFB9_RS13835 WP_417067896.1 2985715..2986131(-) (pilE) [Niveibacterium terrae strain 24SJ04S-2]
MNKMQKGFTLIELMIVVAIIGILAAIALPAYQDYTKRSHVTEGLTLAAGAKAAVTEFYSSKGAWPAANGSAGLAADTSIK
GNAVNSVAVSGSLITVTFNTKVAPGATLFLQGHDTNGTVSWTCTGGTLVSKYRPSNCR

Nucleotide

• Length: 417 bp

>NTDB_id=1067420 ACHFB9_RS13835 WP_417067896.1 2985715..2986131(-) (pilE) [Niveibacterium terrae strain 24SJ04S-2]
ATGAACAAGATGCAAAAAGGTTTCACGCTGATCGAACTGATGATCGTCGTCGCGATCATCGGTATCCTGGCCGCCATCGC
GCTGCCCGCTTACCAAGACTACACTAAGCGTTCGCACGTTACCGAGGGCTTGACTCTGGCTGCCGGTGCCAAGGCTGCTG
TGACCGAGTTCTACTCGTCGAAGGGCGCTTGGCCGGCGGCAAACGGTTCGGCTGGTCTCGCCGCCGACACTTCGATCAAG
GGCAATGCCGTCAACTCCGTGGCGGTTTCTGGTTCGCTGATCACCGTGACCTTCAACACCAAGGTCGCCCCGGGTGCCAC
GCTCTTCTTGCAGGGGCACGATACGAATGGCACGGTCTCCTGGACTTGCACCGGCGGTACCCTTGTTTCCAAGTATCGTC
CTTCGAACTGCCGCTGA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (37-138)

• Prokaryotic N-terminal methylation motif (N_methyl) (3-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae MS11	46.875	100	0.543
pilA	Ralstonia pseudosolanacearum GMI1000	43.787	100	0.536
pilA2	Legionella pneumophila strain ERS1305867	53.333	97.826	0.522
pilE	Neisseria gonorrhoeae strain FA1090	44.937	100	0.514
pilA2	Legionella pneumophila str. Paris	52.985	97.101	0.514
comP	Acinetobacter baylyi ADP1	47.222	100	0.493
pilA/pilAII	Pseudomonas stutzeri DSM 10701	42.446	100	0.428
pilA	Vibrio cholerae C6706	40	100	0.42
pilA	Vibrio cholerae strain A1552	40	100	0.42
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	40	100	0.42
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.714	100	0.413
pilA	Vibrio parahaemolyticus RIMD 2210633	39.844	92.754	0.37
pilA	Haemophilus influenzae Rd KW20	40.8	90.58	0.37