Detailed information NTG1043532

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: ACD269_RS09870
• Genome accession: NZ_CP168260
• Coordinates: 1903198..1903521 (-)
• Length: 107 a.a.
• NCBI ID: WP_000738628.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain FC2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1898198..1908521

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACD269_RS09835 (ACD269_09835)	comYH	1898338..1899291 (-)	954	WP_000345132.1	class I SAM-dependent methyltransferase	Machinery gene
ACD269_RS09840 (ACD269_09840)	-	1899637..1900439 (+)	803	Protein_1913	IS5 family transposase	-
ACD269_RS09845 (ACD269_09845)	-	1900590..1901066 (+)	477	WP_000777686.1	GNAT family N-acetyltransferase	-
ACD269_RS09850 (ACD269_09850)	comGG/cglG	1901721..1902134 (-)	414	WP_000265615.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACD269_RS09855 (ACD269_09855)	comGF/cglF	1902112..1902573 (-)	462	WP_000250520.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACD269_RS09860 (ACD269_09860)	comGE/cglE	1902536..1902838 (-)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACD269_RS09865 (ACD269_09865)	comGD/cglD	1902801..1903235 (-)	435	WP_033606693.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACD269_RS09870 (ACD269_09870)	comGC/cglC	1903198..1903521 (-)	324	WP_000738628.1	comG operon protein ComGC	Machinery gene
ACD269_RS09875 (ACD269_09875)	comGB/cglB	1903523..1904539 (-)	1017	WP_078141518.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACD269_RS09880 (ACD269_09880)	comGA/cglA/cilD	1904487..1905428 (-)	942	WP_000249572.1	competence type IV pilus ATPase ComGA	Machinery gene
ACD269_RS09885 (ACD269_09885)	-	1905504..1905869 (-)	366	WP_000286415.1	DUF1033 family protein	-
ACD269_RS09890 (ACD269_09890)	-	1906020..1907078 (-)	1059	WP_000649465.1	zinc-dependent alcohol dehydrogenase family protein	-
ACD269_RS09895 (ACD269_09895)	nagA	1907241..1908392 (-)	1152	WP_001134457.1	N-acetylglucosamine-6-phosphate deacetylase	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12232.41 Da
• Isoelectric Point: 9.8887

>NTDB_id=1043532 ACD269_RS09870 WP_000738628.1 1903198..1903521(-) (comGC/cglC) [Streptococcus pneumoniae strain FC2]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQD
DGRITEEQAKAYKEYHDKQNTSQIVKD

Nucleotide

• Length: 324 bp

>NTDB_id=1043532 ACD269_RS09870 WP_000738628.1 1903198..1903521(-) (comGC/cglC) [Streptococcus pneumoniae strain FC2]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGAC
GATGGACGCATCACGGAAGAACAGGCTAAAGCCTATAAAGAATACCATGATAAACAAAATACTAGTCAAATCGTTAAAGA
TTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis NCTC 12261	93.458	100	0.935
comGC/cglC	Streptococcus pneumoniae D39	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae R6	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae Rx1	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae TIGR4	93.204	96.262	0.897
comGC/cglC	Streptococcus mitis SK321	88.35	96.262	0.85
comYC	Streptococcus gordonii str. Challis substr. CH1	69.388	91.589	0.636
comYC	Streptococcus mutans UA140	64.211	88.785	0.57
comYC	Streptococcus mutans UA159	64.211	88.785	0.57
comYC	Streptococcus suis isolate S10	69.136	75.701	0.523
comGC	Lactococcus lactis subsp. cremoris KW2	54.639	90.654	0.495
comGC	Staphylococcus aureus MW2	48.837	80.374	0.393
comGC	Staphylococcus aureus N315	48.837	80.374	0.393
comGC	Latilactobacillus sakei subsp. sakei 23K	45.349	80.374	0.364