Detailed information
Bioinformatically predicted
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | ACCQ09_RS05230 | Genome accession | NZ_CP167854 |
| Coordinates | 1241454..1241852 (+) | Length | 132 a.a. |
| NCBI ID | WP_040940799.1 | Uniprot ID | - |
| Organism | Xanthomonas sp. NCPPB 2586 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1202955..1259697 | 1241454..1241852 | within | 0 |
Gene organization within MGE regions
Location: 1202955..1259697
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACCQ09_RS05035 (ACCQ09_05035) | - | 1203795..1204028 (+) | 234 | WP_162866359.1 | hypothetical protein | - |
| ACCQ09_RS05040 (ACCQ09_05040) | - | 1204025..1204591 (+) | 567 | WP_162866360.1 | hypothetical protein | - |
| ACCQ09_RS05045 (ACCQ09_05045) | - | 1204710..1205045 (-) | 336 | WP_040940781.1 | hypothetical protein | - |
| ACCQ09_RS05050 (ACCQ09_05050) | - | 1205042..1205356 (-) | 315 | WP_014090899.1 | hypothetical protein | - |
| ACCQ09_RS05055 (ACCQ09_05055) | - | 1205406..1206167 (-) | 762 | WP_040942245.1 | hypothetical protein | - |
| ACCQ09_RS05060 (ACCQ09_05060) | - | 1206329..1206610 (+) | 282 | WP_040940782.1 | helix-turn-helix domain-containing protein | - |
| ACCQ09_RS05065 (ACCQ09_05065) | dndC | 1206742..1207899 (+) | 1158 | WP_228427691.1 | DNA phosphorothioation system sulfurtransferase DndC | - |
| ACCQ09_RS05070 (ACCQ09_05070) | - | 1207920..1208135 (+) | 216 | WP_014090894.1 | DNA modification system-associated small protein | - |
| ACCQ09_RS05075 (ACCQ09_05075) | dndD | 1208125..1210203 (+) | 2079 | WP_014090893.1 | DNA sulfur modification protein DndD | - |
| ACCQ09_RS05080 (ACCQ09_05080) | - | 1210205..1211734 (+) | 1530 | WP_040940783.1 | DndE family protein | - |
| ACCQ09_RS05085 (ACCQ09_05085) | - | 1211794..1212156 (-) | 363 | WP_080640037.1 | type II toxin-antitoxin system RnlB family antitoxin | - |
| ACCQ09_RS05090 (ACCQ09_05090) | - | 1212153..1213052 (-) | 900 | WP_372386272.1 | RNase LS family HEPN domain-containing protein | - |
| ACCQ09_RS05095 (ACCQ09_05095) | - | 1213278..1214678 (-) | 1401 | WP_040940784.1 | site-specific integrase | - |
| ACCQ09_RS05100 (ACCQ09_05100) | - | 1215224..1215448 (+) | 225 | WP_040940785.1 | hypothetical protein | - |
| ACCQ09_RS05105 (ACCQ09_05105) | - | 1215817..1216296 (+) | 480 | WP_040940786.1 | RadC family protein | - |
| ACCQ09_RS05110 (ACCQ09_05110) | - | 1216577..1217206 (+) | 630 | WP_040942248.1 | DUF1629 domain-containing protein | - |
| ACCQ09_RS05115 (ACCQ09_05115) | - | 1217242..1221198 (+) | 3957 | WP_040940787.1 | MAP7 domain-containing protein | - |
| ACCQ09_RS05120 (ACCQ09_05120) | - | 1221263..1221889 (+) | 627 | WP_197708550.1 | hypothetical protein | - |
| ACCQ09_RS05125 (ACCQ09_05125) | - | 1221901..1223136 (-) | 1236 | WP_040940788.1 | HNH endonuclease | - |
| ACCQ09_RS05130 (ACCQ09_05130) | - | 1223184..1223744 (-) | 561 | WP_040942250.1 | hypothetical protein | - |
| ACCQ09_RS05135 (ACCQ09_05135) | - | 1223738..1224088 (-) | 351 | WP_078515451.1 | HNH endonuclease | - |
| ACCQ09_RS05140 (ACCQ09_05140) | - | 1224270..1224596 (-) | 327 | WP_040940789.1 | hypothetical protein | - |
| ACCQ09_RS05145 (ACCQ09_05145) | - | 1224863..1226458 (+) | 1596 | WP_040940790.1 | MobA/MobL family protein | - |
| ACCQ09_RS05150 (ACCQ09_05150) | - | 1226511..1226852 (-) | 342 | WP_040940791.1 | hypothetical protein | - |
| ACCQ09_RS05155 (ACCQ09_05155) | - | 1227554..1227982 (+) | 429 | WP_012437589.1 | hypothetical protein | - |
| ACCQ09_RS05160 (ACCQ09_05160) | - | 1228225..1228455 (-) | 231 | WP_162866361.1 | hypothetical protein | - |
| ACCQ09_RS05165 (ACCQ09_05165) | - | 1228519..1228665 (+) | 147 | WP_040940792.1 | hypothetical protein | - |
| ACCQ09_RS05170 (ACCQ09_05170) | - | 1228850..1229245 (+) | 396 | WP_042594933.1 | hypothetical protein | - |
| ACCQ09_RS05175 (ACCQ09_05175) | - | 1229336..1229728 (+) | 393 | WP_012437593.1 | H-NS family nucleoid-associated regulatory protein | - |
| ACCQ09_RS05180 (ACCQ09_05180) | glgX | 1230253..1232382 (-) | 2130 | WP_016945001.1 | glycogen debranching protein GlgX | - |
| ACCQ09_RS05185 (ACCQ09_05185) | rimK | 1232875..1233750 (+) | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ACCQ09_RS05190 (ACCQ09_05190) | - | 1234400..1235077 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ACCQ09_RS05195 (ACCQ09_05195) | - | 1235070..1236404 (+) | 1335 | WP_057671653.1 | HAMP domain-containing sensor histidine kinase | - |
| ACCQ09_RS05200 (ACCQ09_05200) | - | 1236547..1237038 (-) | 492 | WP_040940794.1 | GNAT family N-acetyltransferase | - |
| ACCQ09_RS05205 (ACCQ09_05205) | - | 1237035..1237325 (-) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ACCQ09_RS05210 (ACCQ09_05210) | - | 1237400..1237801 (-) | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| ACCQ09_RS05215 (ACCQ09_05215) | coaE | 1238333..1238956 (-) | 624 | WP_040940796.1 | dephospho-CoA kinase | - |
| ACCQ09_RS05220 (ACCQ09_05220) | - | 1238970..1239833 (-) | 864 | WP_040940797.1 | A24 family peptidase | - |
| ACCQ09_RS05225 (ACCQ09_05225) | pilC | 1239840..1241102 (-) | 1263 | WP_040940798.1 | type II secretion system F family protein | Machinery gene |
| ACCQ09_RS05230 (ACCQ09_05230) | pilA/pilAI | 1241454..1241852 (+) | 399 | WP_040940799.1 | pilin | Machinery gene |
| ACCQ09_RS05235 (ACCQ09_05235) | - | 1241957..1242379 (+) | 423 | WP_040940800.1 | pilin | - |
| ACCQ09_RS05240 (ACCQ09_05240) | - | 1242438..1244258 (+) | 1821 | WP_162866362.1 | hypothetical protein | - |
| ACCQ09_RS05245 (ACCQ09_05245) | - | 1244382..1245140 (+) | 759 | WP_080640038.1 | class I SAM-dependent methyltransferase | - |
| ACCQ09_RS05250 (ACCQ09_05250) | - | 1245562..1246323 (+) | 762 | WP_162866363.1 | glycosyltransferase family 9 protein | - |
| ACCQ09_RS05255 (ACCQ09_05255) | - | 1246326..1247168 (-) | 843 | WP_162866364.1 | glycosyltransferase | - |
| ACCQ09_RS05260 (ACCQ09_05260) | - | 1247162..1248334 (-) | 1173 | WP_162866365.1 | glycosyltransferase | - |
| ACCQ09_RS05265 (ACCQ09_05265) | - | 1248319..1249182 (-) | 864 | WP_080640041.1 | glycosyltransferase | - |
| ACCQ09_RS05270 (ACCQ09_05270) | - | 1249232..1250083 (-) | 852 | WP_108133901.1 | glycosyltransferase family 2 protein | - |
| ACCQ09_RS05275 (ACCQ09_05275) | pilB | 1250239..1251975 (+) | 1737 | WP_040940802.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ACCQ09_RS05280 (ACCQ09_05280) | pilR | 1253360..1254754 (-) | 1395 | WP_040940803.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ACCQ09_RS05285 (ACCQ09_05285) | - | 1254964..1256574 (-) | 1611 | WP_227971326.1 | HAMP domain-containing sensor histidine kinase | - |
| ACCQ09_RS05290 (ACCQ09_05290) | sucC | 1256808..1257977 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ACCQ09_RS05295 (ACCQ09_05295) | sucD | 1258002..1258877 (+) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ACCQ09_RS05300 (ACCQ09_05300) | - | 1258981..1259391 (+) | 411 | WP_029217117.1 | CopG family ribbon-helix-helix protein | - |
| ACCQ09_RS05305 (ACCQ09_05305) | - | 1259395..1259697 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13892.15 Da Isoelectric Point: 8.8371
>NTDB_id=1039875 ACCQ09_RS05230 WP_040940799.1 1241454..1241852(+) (pilA/pilAI) [Xanthomonas sp. NCPPB 2586]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEINPGKTQYEVLVNEGTIPTSATQIGLTTPTARCTV
TVSSTGIQCLLKGNASKINNKTIRLNRDATAGTWTCVTGAGLEDKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKSQATAGLAEINPGKTQYEVLVNEGTIPTSATQIGLTTPTARCTV
TVSSTGIQCLLKGNASKINNKTIRLNRDATAGTWTCVTGAGLEDKYKPAGCS
Nucleotide
Download Length: 399 bp
>NTDB_id=1039875 ACCQ09_RS05230 WP_040940799.1 1241454..1241852(+) (pilA/pilAI) [Xanthomonas sp. NCPPB 2586]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATTAATCCTGGTAAAACGCAGTACG
AAGTATTAGTTAACGAAGGCACGATCCCTACCAGCGCTACGCAGATTGGTTTAACGACTCCCACTGCGCGCTGTACTGTA
ACTGTCAGCAGCACCGGCATCCAGTGTCTTCTCAAAGGCAACGCGTCCAAGATCAATAACAAGACTATTCGCCTTAACCG
TGATGCAACAGCTGGTACTTGGACATGTGTGACTGGCGCAGGGTTGGAAGATAAGTATAAGCCCGCCGGTTGTTCCTAA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTAGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGTCGCAGGCGACTGCCGGTCTGGCAGAAATTAATCCTGGTAAAACGCAGTACG
AAGTATTAGTTAACGAAGGCACGATCCCTACCAGCGCTACGCAGATTGGTTTAACGACTCCCACTGCGCGCTGTACTGTA
ACTGTCAGCAGCACCGGCATCCAGTGTCTTCTCAAAGGCAACGCGTCCAAGATCAATAACAAGACTATTCGCCTTAACCG
TGATGCAACAGCTGGTACTTGGACATGTGTGACTGGCGCAGGGTTGGAAGATAAGTATAAGCCCGCCGGTTGTTCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
54.015 |
100 |
0.561 |
| pilA | Acinetobacter baumannii strain A118 |
48.936 |
100 |
0.523 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
45.185 |
100 |
0.462 |
| pilA | Pseudomonas aeruginosa PAK |
38.312 |
100 |
0.447 |
| pilA/pilA1 | Eikenella corrodens VA1 |
37.584 |
100 |
0.424 |
| comP | Acinetobacter baylyi ADP1 |
37.162 |
100 |
0.417 |
| pilA | Vibrio cholerae C6706 |
38.194 |
100 |
0.417 |
| pilA | Vibrio cholerae strain A1552 |
38.194 |
100 |
0.417 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
38.194 |
100 |
0.417 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
39.416 |
100 |
0.409 |
| pilA2 | Legionella pneumophila str. Paris |
38.686 |
100 |
0.402 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
41.085 |
97.727 |
0.402 |
| pilA | Haemophilus influenzae Rd KW20 |
41.322 |
91.667 |
0.379 |