Detailed information NTG1033412

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: AB8808_RS06005
• Genome accession: NZ_CP166101
• Coordinates: 1524452..1524898 (+)
• Length: 148 a.a.
• NCBI ID: WP_369930559.1
• Uniprot ID: -
• Organism: Xanthomonas sp. NCPPB 2632
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1523714..1539219	1524452..1524898	within	0

Gene organization within MGE regions

Location: 1523714..1539219

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB8808_RS06000 (AB8808_06000)	-	1523714..1524148 (+)	435	WP_369930558.1	pilin	-
AB8808_RS06005 (AB8808_06005)	pilE	1524452..1524898 (+)	447	WP_369930559.1	pilin	Machinery gene
AB8808_RS06010 (AB8808_06010)	-	1524978..1526996 (+)	2019	WP_369930561.1	tetratricopeptide repeat protein	-
AB8808_RS06015 (AB8808_06015)	-	1527049..1529028 (+)	1980	WP_369930562.1	hypothetical protein	-
AB8808_RS06020 (AB8808_06020)	-	1529025..1530254 (+)	1230	WP_369930563.1	lipopolysaccharide biosynthesis protein	-
AB8808_RS06025 (AB8808_06025)	-	1530260..1531132 (-)	873	WP_369930564.1	hypothetical protein	-
AB8808_RS06030 (AB8808_06030)	-	1531137..1532237 (-)	1101	WP_369930565.1	class I SAM-dependent methyltransferase	-
AB8808_RS06035 (AB8808_06035)	-	1532240..1533193 (-)	954	WP_369930566.1	rhamnosyltransferase	-
AB8808_RS06040 (AB8808_06040)	-	1533165..1534310 (-)	1146	WP_369930568.1	glycosyltransferase family 4 protein	-
AB8808_RS06045 (AB8808_06045)	-	1534317..1535048 (-)	732	WP_369930569.1	methyltransferase domain-containing protein	-
AB8808_RS06050 (AB8808_06050)	-	1535045..1535911 (-)	867	WP_369930570.1	glycosyltransferase family 2 protein	-
AB8808_RS06055 (AB8808_06055)	pilB	1536082..1537809 (+)	1728	WP_369930571.1	type IV-A pilus assembly ATPase PilB	Machinery gene
AB8808_RS06060 (AB8808_06060)	pilC	1537954..1539219 (+)	1266	WP_369930572.1	type II secretion system F family protein	Machinery gene

Sequence

Protein

• Length: 148 a.a.
• Molecular weight: 15490.79 Da
• Isoelectric Point: 9.9039

>NTDB_id=1033412 AB8808_RS06005 WP_369930559.1 1524452..1524898(+) (pilE) [Xanthomonas sp. NCPPB 2632]
MKNVQKGFTLIELMIVVAIIAILAAIAIPAYQDYTIRSQVSEGPVLADGAKTAVAEFFQNTGRFPKSNTSAGLAVNKSIK
GQYVSQIDVDTGATGLITATYGGPKASNKIGTNATLLLSPISNAGSISWTCKSTTIKSNYLPSNCRTS

Nucleotide

• Length: 447 bp

>NTDB_id=1033412 AB8808_RS06005 WP_369930559.1 1524452..1524898(+) (pilE) [Xanthomonas sp. NCPPB 2632]
ATGAAGAACGTACAGAAAGGCTTTACCCTGATCGAACTGATGATCGTCGTTGCGATCATCGCCATCCTGGCCGCCATCGC
CATCCCGGCTTACCAGGACTACACCATCCGCTCGCAGGTCTCGGAAGGTCCGGTCCTCGCTGACGGCGCCAAGACGGCTG
TCGCGGAGTTCTTCCAGAATACCGGCCGCTTCCCGAAGTCGAACACCTCGGCGGGCCTTGCGGTCAACAAGTCCATCAAG
GGCCAGTACGTTTCACAGATCGACGTCGACACCGGCGCTACCGGCCTGATCACCGCCACCTATGGCGGCCCCAAAGCCAG
CAATAAGATCGGCACAAACGCGACGCTGCTGCTCTCGCCGATCTCGAACGCTGGCAGCATTTCCTGGACCTGCAAGAGCA
CGACGATCAAGAGCAACTACCTGCCGTCGAACTGCCGCACCTCGTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (37-146)

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae MS11	44.172	100	0.486
pilE	Neisseria gonorrhoeae strain FA1090	44.444	100	0.486
pilA	Ralstonia pseudosolanacearum GMI1000	41.42	100	0.473
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	36.649	100	0.473
comP	Acinetobacter baylyi ADP1	44.371	100	0.453
pilA2	Legionella pneumophila strain ERS1305867	46.154	96.622	0.446
pilA2	Legionella pneumophila str. Paris	46.154	96.622	0.446
pilA/pilA1	Eikenella corrodens VA1	40.764	100	0.432
pilA/pilAI	Pseudomonas stutzeri DSM 10701	39.474	100	0.405
pilA	Acinetobacter baumannii strain A118	40.69	97.973	0.399
pilA	Pseudomonas aeruginosa PAK	35.714	100	0.372