Detailed information
Bioinformatically predicted
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | ABFU17_RS16880 | Genome accession | NZ_CP156007 |
| Coordinates | 3822277..3822708 (-) | Length | 143 a.a. |
| NCBI ID | WP_024939397.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain bglFP 6745 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3812182..3865278 | 3822277..3822708 | within | 0 |
Gene organization within MGE regions
Location: 3812182..3865278
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU17_RS16830 (ABFU17_16820) | - | 3812182..3812484 (-) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ABFU17_RS16835 (ABFU17_16825) | - | 3812488..3812898 (-) | 411 | WP_029217117.1 | CopG family ribbon-helix-helix protein | - |
| ABFU17_RS16840 (ABFU17_16830) | sucD | 3813002..3813877 (-) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU17_RS16845 (ABFU17_16835) | sucC | 3813902..3815071 (-) | 1170 | WP_012437609.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU17_RS16850 (ABFU17_16840) | - | 3815305..3816915 (+) | 1611 | WP_283269172.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU17_RS16855 (ABFU17_16845) | pilR | 3817124..3818518 (+) | 1395 | WP_043921909.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU17_RS16860 (ABFU17_16850) | - | 3818809..3819072 (+) | 264 | WP_407366831.1 | hypothetical protein | - |
| ABFU17_RS16865 (ABFU17_16855) | - | 3819072..3819809 (+) | 738 | WP_283269169.1 | zeta toxin family protein | - |
| ABFU17_RS16870 (ABFU17_16860) | pilB | 3819992..3821725 (-) | 1734 | WP_283269167.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU17_RS16875 (ABFU17_16865) | - | 3821767..3822180 (-) | 414 | WP_283269165.1 | pilin | - |
| ABFU17_RS16880 (ABFU17_16870) | comP | 3822277..3822708 (-) | 432 | WP_024939397.1 | pilin | Machinery gene |
| ABFU17_RS16885 (ABFU17_16875) | pilC | 3823056..3824315 (+) | 1260 | WP_407366832.1 | type II secretion system F family protein | Machinery gene |
| ABFU17_RS16890 (ABFU17_16880) | - | 3824322..3825185 (+) | 864 | WP_040940797.1 | A24 family peptidase | - |
| ABFU17_RS16895 (ABFU17_16885) | coaE | 3825199..3825822 (+) | 624 | WP_228424129.1 | dephospho-CoA kinase | - |
| ABFU17_RS16900 (ABFU17_16890) | - | 3826351..3826752 (+) | 402 | WP_283269159.1 | SymE family type I addiction module toxin | - |
| ABFU17_RS16905 (ABFU17_16895) | - | 3826827..3827117 (+) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ABFU17_RS16910 (ABFU17_16900) | - | 3827114..3827605 (+) | 492 | WP_223646366.1 | GNAT family N-acetyltransferase | - |
| ABFU17_RS16915 (ABFU17_16905) | - | 3827748..3829082 (-) | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU17_RS16920 (ABFU17_16910) | - | 3829075..3829752 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU17_RS16925 (ABFU17_16915) | rimK | 3830402..3831277 (-) | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU17_RS16930 (ABFU17_16920) | glgX | 3831770..3833899 (+) | 2130 | WP_283269153.1 | glycogen debranching protein GlgX | - |
| ABFU17_RS16935 (ABFU17_16925) | - | 3834438..3834830 (-) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU17_RS16940 (ABFU17_16930) | - | 3834921..3835316 (-) | 396 | WP_011038225.1 | hypothetical protein | - |
| ABFU17_RS16945 (ABFU17_16935) | - | 3835501..3835647 (-) | 147 | WP_116889157.1 | hypothetical protein | - |
| ABFU17_RS16950 (ABFU17_16940) | - | 3835711..3835941 (+) | 231 | WP_283269150.1 | hypothetical protein | - |
| ABFU17_RS16955 (ABFU17_16945) | - | 3836231..3836647 (-) | 417 | WP_283269148.1 | hypothetical protein | - |
| ABFU17_RS16960 (ABFU17_16950) | - | 3837303..3837644 (+) | 342 | WP_283269146.1 | hypothetical protein | - |
| ABFU17_RS16965 (ABFU17_16955) | - | 3837697..3839292 (-) | 1596 | WP_345782102.1 | MobA/MobL family protein | - |
| ABFU17_RS16970 (ABFU17_16960) | - | 3839320..3840452 (+) | 1133 | WP_087942069.1 | IS3-like element IS476 family transposase | - |
| ABFU17_RS16975 (ABFU17_16965) | - | 3840690..3841916 (-) | 1227 | WP_167766504.1 | hypothetical protein | - |
| ABFU17_RS16980 (ABFU17_16970) | - | 3841970..3842317 (-) | 348 | WP_407366835.1 | hypothetical protein | - |
| ABFU17_RS16985 (ABFU17_16975) | - | 3842319..3843923 (-) | 1605 | WP_407366837.1 | hypothetical protein | - |
| ABFU17_RS16990 (ABFU17_16980) | - | 3844272..3844922 (-) | 651 | WP_167766506.1 | hypothetical protein | - |
| ABFU17_RS16995 (ABFU17_16985) | - | 3844962..3848984 (-) | 4023 | WP_283269140.1 | hypothetical protein | - |
| ABFU17_RS17000 (ABFU17_16990) | - | 3849018..3849614 (-) | 597 | WP_345782097.1 | DUF1629 domain-containing protein | - |
| ABFU17_RS17005 (ABFU17_16995) | - | 3849753..3850232 (-) | 480 | WP_407366839.1 | RadC family protein | - |
| ABFU17_RS17010 (ABFU17_17000) | - | 3850641..3850856 (-) | 216 | WP_167766510.1 | hypothetical protein | - |
| ABFU17_RS17015 (ABFU17_17005) | - | 3851402..3851560 (+) | 159 | Protein_3283 | integrase | - |
| ABFU17_RS17020 (ABFU17_17010) | - | 3851594..3852696 (-) | 1103 | Protein_3284 | IS3-like element IS1404 family transposase | - |
| ABFU17_RS17025 (ABFU17_17015) | - | 3852762..3854006 (+) | 1245 | Protein_3285 | site-specific integrase | - |
| ABFU17_RS17030 (ABFU17_17020) | - | 3854189..3854524 (-) | 336 | WP_167766512.1 | hypothetical protein | - |
| ABFU17_RS17035 (ABFU17_17025) | - | 3854551..3856080 (-) | 1530 | WP_209271699.1 | ATP-binding protein | - |
| ABFU17_RS17040 (ABFU17_17030) | - | 3856082..3856762 (-) | 681 | WP_407366841.1 | hypothetical protein | - |
| ABFU17_RS17045 (ABFU17_17035) | - | 3856827..3858161 (-) | 1335 | WP_407366843.1 | AAA family ATPase | - |
| ABFU17_RS17050 (ABFU17_17045) | dndC | 3858387..3859517 (-) | 1131 | WP_167766515.1 | DNA phosphorothioation system sulfurtransferase DndC | - |
| ABFU17_RS17055 (ABFU17_17050) | - | 3859688..3859969 (-) | 282 | WP_407366844.1 | helix-turn-helix domain-containing protein | - |
| ABFU17_RS17060 (ABFU17_17055) | - | 3860131..3860892 (+) | 762 | WP_283269134.1 | hypothetical protein | - |
| ABFU17_RS17065 (ABFU17_17060) | - | 3860935..3861249 (+) | 315 | WP_283269132.1 | hypothetical protein | - |
| ABFU17_RS17070 (ABFU17_17065) | - | 3861267..3861626 (+) | 360 | WP_167766613.1 | hypothetical protein | - |
| ABFU17_RS17075 (ABFU17_17070) | - | 3862097..3862960 (+) | 864 | WP_167766519.1 | hypothetical protein | - |
| ABFU17_RS17080 (ABFU17_17075) | - | 3862976..3863722 (+) | 747 | WP_167766520.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 14594.80 Da Isoelectric Point: 8.4781
>NTDB_id=1001107 ABFU17_RS16880 WP_024939397.1 3822277..3822708(-) (comP) [Xanthomonas campestris pv. campestris strain bglFP 6745]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSELAVMASSFKTTVAENIANNGGALPADACVGVGATAATTN
MASIACTPASGNIVVTGDATKTKGTILTYAPTIPAAGNSAVGTTWTCTGSGSQTKYYPAECRR
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSELAVMASSFKTTVAENIANNGGALPADACVGVGATAATTN
MASIACTPASGNIVVTGDATKTKGTILTYAPTIPAAGNSAVGTTWTCTGSGSQTKYYPAECRR
Nucleotide
Download Length: 432 bp
>NTDB_id=1001107 ABFU17_RS16880 WP_024939397.1 3822277..3822708(-) (comP) [Xanthomonas campestris pv. campestris strain bglFP 6745]
ATGAAGAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTTGCGATCATCGCCATCCTAGCCGCCATCGCGCT
TCCGGCGTATCAGGACTACACCATTCGCTCGCGCGTCTCGGAACTGGCTGTGATGGCTAGCTCCTTCAAGACCACCGTCG
CAGAAAATATAGCTAACAACGGCGGCGCTTTGCCGGCTGATGCTTGCGTGGGTGTTGGTGCTACGGCTGCGACTACCAAC
ATGGCGTCCATCGCCTGTACTCCCGCTTCTGGCAATATCGTTGTTACCGGTGATGCAACCAAAACTAAGGGTACGATTTT
GACCTACGCGCCCACCATTCCTGCGGCGGGCAACTCTGCGGTTGGTACGACCTGGACGTGCACGGGTAGCGGTAGCCAGA
CAAAGTACTATCCGGCTGAGTGCCGCCGCTAA
ATGAAGAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTTGCGATCATCGCCATCCTAGCCGCCATCGCGCT
TCCGGCGTATCAGGACTACACCATTCGCTCGCGCGTCTCGGAACTGGCTGTGATGGCTAGCTCCTTCAAGACCACCGTCG
CAGAAAATATAGCTAACAACGGCGGCGCTTTGCCGGCTGATGCTTGCGTGGGTGTTGGTGCTACGGCTGCGACTACCAAC
ATGGCGTCCATCGCCTGTACTCCCGCTTCTGGCAATATCGTTGTTACCGGTGATGCAACCAAAACTAAGGGTACGATTTT
GACCTACGCGCCCACCATTCCTGCGGCGGGCAACTCTGCGGTTGGTACGACCTGGACGTGCACGGGTAGCGGTAGCCAGA
CAAAGTACTATCCGGCTGAGTGCCGCCGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Acinetobacter baylyi ADP1 |
53.595 |
100 |
0.573 |
| pilA2 | Legionella pneumophila str. Paris |
55.634 |
99.301 |
0.552 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
54.93 |
99.301 |
0.545 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
40.244 |
100 |
0.462 |
| pilA | Vibrio campbellii strain DS40M4 |
41.611 |
100 |
0.434 |
| pilA | Pseudomonas aeruginosa PAK |
37.342 |
100 |
0.413 |
| pilA/pilA1 | Eikenella corrodens VA1 |
38.816 |
100 |
0.413 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.278 |
100 |
0.406 |
| pilA | Haemophilus influenzae 86-028NP |
39.161 |
100 |
0.392 |
| pilA | Haemophilus influenzae Rd KW20 |
38.462 |
100 |
0.385 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
37.241 |
100 |
0.378 |
| pilA | Glaesserella parasuis strain SC1401 |
37.063 |
100 |
0.371 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
41.085 |
90.21 |
0.371 |