Detailed information
Bioinformatically predicted
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | ABFU22_RS05265 | Genome accession | NZ_CP155946 |
| Coordinates | 1244310..1244738 (+) | Length | 142 a.a. |
| NCBI ID | WP_057671660.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain 0483 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1160616..1254414 | 1244310..1244738 | within | 0 |
Gene organization within MGE regions
Location: 1160616..1254414
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU22_RS04920 (ABFU22_04905) | - | 1160945..1161841 (-) | 897 | Protein_954 | ATP-binding protein | - |
| ABFU22_RS04925 (ABFU22_04910) | - | 1161838..1165044 (-) | 3207 | WP_274375510.1 | TerB N-terminal domain-containing protein | - |
| ABFU22_RS04930 (ABFU22_04915) | - | 1165220..1167793 (+) | 2574 | WP_081020869.1 | AAA family ATPase | - |
| ABFU22_RS04935 (ABFU22_04920) | - | 1167905..1168981 (-) | 1077 | WP_274375511.1 | hypothetical protein | - |
| ABFU22_RS04940 (ABFU22_04925) | - | 1169519..1170688 (-) | 1170 | WP_407370258.1 | site-specific integrase | - |
| ABFU22_RS04945 (ABFU22_04930) | - | 1171584..1172727 (+) | 1144 | WP_283502933.1 | IS3 family transposase | - |
| ABFU22_RS04950 (ABFU22_04935) | - | 1173040..1174728 (+) | 1689 | WP_233362759.1 | type IV secretory system conjugative DNA transfer family protein | - |
| ABFU22_RS04955 (ABFU22_04940) | - | 1174740..1175411 (+) | 672 | WP_274375512.1 | DUF1629 domain-containing protein | - |
| ABFU22_RS04960 (ABFU22_04945) | - | 1175452..1176090 (+) | 639 | WP_233362757.1 | DUF1629 domain-containing protein | - |
| ABFU22_RS04965 (ABFU22_04950) | - | 1176138..1179740 (+) | 3603 | WP_274375513.1 | peptidoglycan-binding protein | - |
| ABFU22_RS04970 (ABFU22_04955) | - | 1179976..1181274 (+) | 1299 | WP_043877774.1 | HlyD family secretion protein | - |
| ABFU22_RS04975 (ABFU22_04960) | - | 1181271..1183487 (+) | 2217 | WP_274375514.1 | peptidase domain-containing ABC transporter | - |
| ABFU22_RS04980 (ABFU22_04965) | - | 1183590..1184402 (+) | 813 | WP_274375515.1 | pesticin C-terminus-like muramidase | - |
| ABFU22_RS04985 (ABFU22_04970) | - | 1184432..1184926 (+) | 495 | WP_274375516.1 | hypothetical protein | - |
| ABFU22_RS04990 (ABFU22_04975) | - | 1185126..1185896 (+) | 771 | WP_274375517.1 | hypothetical protein | - |
| ABFU22_RS04995 (ABFU22_04980) | - | 1185963..1186601 (+) | 639 | WP_139328711.1 | hypothetical protein | - |
| ABFU22_RS05000 (ABFU22_04985) | - | 1186645..1187169 (+) | 525 | WP_076038855.1 | hypothetical protein | - |
| ABFU22_RS05005 (ABFU22_04990) | - | 1187286..1187468 (+) | 183 | WP_274375518.1 | hypothetical protein | - |
| ABFU22_RS05010 (ABFU22_04995) | - | 1187575..1188942 (+) | 1368 | WP_011035783.1 | IS5-like element IS1478 family transposase | - |
| ABFU22_RS05015 (ABFU22_05000) | - | 1189359..1190726 (+) | 1368 | WP_011035783.1 | IS5-like element IS1478 family transposase | - |
| ABFU22_RS05020 (ABFU22_05005) | - | 1191143..1192510 (+) | 1368 | WP_011035783.1 | IS5-like element IS1478 family transposase | - |
| ABFU22_RS05025 (ABFU22_05010) | - | 1193051..1194328 (-) | 1278 | WP_131084748.1 | ABC transporter permease | - |
| ABFU22_RS05030 (ABFU22_05015) | - | 1194391..1194822 (-) | 432 | WP_274375519.1 | toxin-activating lysine-acyltransferase | - |
| ABFU22_RS05035 (ABFU22_05020) | - | 1194812..1196626 (-) | 1815 | WP_274375520.1 | protein adenylyltransferase SelO family protein | - |
| ABFU22_RS05040 (ABFU22_05025) | - | 1197221..1197682 (+) | 462 | Protein_978 | MobA/MobL family protein | - |
| ABFU22_RS05045 (ABFU22_05030) | - | 1197575..1197799 (-) | 225 | WP_057672809.1 | hypothetical protein | - |
| ABFU22_RS05050 (ABFU22_05035) | - | 1198870..1199970 (-) | 1101 | WP_076038478.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABFU22_RS05055 (ABFU22_05040) | - | 1199967..1200563 (-) | 597 | WP_076038479.1 | hypothetical protein | - |
| ABFU22_RS05060 (ABFU22_05045) | - | 1200893..1202442 (+) | 1550 | Protein_982 | tyrosine-type recombinase/integrase | - |
| ABFU22_RS05065 (ABFU22_05050) | - | 1202523..1202951 (+) | 429 | WP_144410827.1 | hypothetical protein | - |
| ABFU22_RS05070 (ABFU22_05055) | - | 1203336..1204124 (-) | 789 | WP_144410826.1 | hypothetical protein | - |
| ABFU22_RS05075 (ABFU22_05060) | - | 1204723..1205543 (+) | 821 | Protein_985 | IS3-like element ISXca1 family transposase | - |
| ABFU22_RS05080 (ABFU22_05065) | - | 1205612..1206714 (+) | 1103 | WP_100101058.1 | IS3-like element IS1404 family transposase | - |
| ABFU22_RS05085 (ABFU22_05070) | - | 1207195..1207773 (+) | 579 | WP_349747897.1 | hypothetical protein | - |
| ABFU22_RS05090 (ABFU22_05075) | - | 1208011..1208250 (+) | 240 | WP_274375523.1 | hypothetical protein | - |
| ABFU22_RS05095 (ABFU22_05080) | - | 1208533..1208760 (+) | 228 | Protein_989 | DNA repair protein RadC | - |
| ABFU22_RS05100 (ABFU22_05085) | - | 1208877..1209857 (-) | 981 | WP_012438063.1 | IS5-like element IS1646 family transposase | - |
| ABFU22_RS05105 (ABFU22_05090) | - | 1209921..1210259 (+) | 339 | Protein_991 | RadC family protein | - |
| ABFU22_RS05110 (ABFU22_05095) | - | 1210332..1211486 (+) | 1155 | WP_274339168.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABFU22_RS05115 (ABFU22_05100) | - | 1212069..1212545 (+) | 477 | Protein_993 | thermonuclease family protein | - |
| ABFU22_RS05120 (ABFU22_05105) | - | 1212679..1213320 (+) | 642 | WP_274375524.1 | DUF1629 domain-containing protein | - |
| ABFU22_RS05125 (ABFU22_05110) | - | 1213357..1217397 (+) | 4041 | WP_274375525.1 | hypothetical protein | - |
| ABFU22_RS05130 (ABFU22_05115) | - | 1217437..1218087 (+) | 651 | WP_274375526.1 | hypothetical protein | - |
| ABFU22_RS05135 (ABFU22_05120) | - | 1218804..1220018 (-) | 1215 | WP_011035386.1 | IS4-like element IS1481A family transposase | - |
| ABFU22_RS05140 (ABFU22_05125) | - | 1220086..1220940 (-) | 855 | WP_274375527.1 | caspase family protein | - |
| ABFU22_RS05145 (ABFU22_05130) | - | 1220937..1221305 (-) | 369 | WP_274339164.1 | TIR domain-containing protein | - |
| ABFU22_RS05150 (ABFU22_05135) | - | 1221472..1222839 (+) | 1368 | WP_011035783.1 | IS5-like element IS1478 family transposase | - |
| ABFU22_RS05160 (ABFU22_05145) | - | 1224469..1226070 (+) | 1602 | WP_337998626.1 | MobA/MobL family protein | - |
| ABFU22_RS05165 (ABFU22_05150) | - | 1226015..1226509 (-) | 495 | WP_274375528.1 | transcriptional regulator | - |
| ABFU22_RS05170 (ABFU22_05155) | - | 1226723..1227703 (-) | 981 | WP_012438063.1 | IS5-like element IS1646 family transposase | - |
| ABFU22_RS05175 (ABFU22_05160) | - | 1227707..1227961 (-) | 255 | WP_274375529.1 | DUF6516 family protein | - |
| ABFU22_RS05180 (ABFU22_05165) | - | 1228026..1228367 (-) | 342 | WP_070689991.1 | hypothetical protein | - |
| ABFU22_RS05185 (ABFU22_05170) | - | 1228739..1229953 (+) | 1215 | WP_011035386.1 | IS4-like element IS1481A family transposase | - |
| ABFU22_RS05190 (ABFU22_05175) | - | 1230423..1230794 (+) | 372 | WP_274375530.1 | hypothetical protein | - |
| ABFU22_RS05195 (ABFU22_05180) | - | 1230927..1231268 (+) | 342 | WP_228441887.1 | hypothetical protein | - |
| ABFU22_RS05200 (ABFU22_05185) | - | 1231386..1231532 (+) | 147 | WP_116889157.1 | hypothetical protein | - |
| ABFU22_RS05205 (ABFU22_05190) | - | 1231717..1232112 (+) | 396 | WP_274375531.1 | hypothetical protein | - |
| ABFU22_RS05210 (ABFU22_05195) | - | 1232203..1232595 (+) | 393 | WP_012437593.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU22_RS05215 (ABFU22_05200) | glgX | 1233119..1235248 (-) | 2130 | WP_057671651.1 | glycogen debranching protein GlgX | - |
| ABFU22_RS05220 (ABFU22_05205) | rimK | 1235741..1236616 (+) | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU22_RS05225 (ABFU22_05210) | - | 1237266..1237943 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU22_RS05230 (ABFU22_05215) | - | 1237936..1239270 (+) | 1335 | WP_227971331.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU22_RS05235 (ABFU22_05220) | - | 1239413..1239904 (-) | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | - |
| ABFU22_RS05240 (ABFU22_05225) | - | 1239901..1240191 (-) | 291 | WP_274375532.1 | DUF1778 domain-containing protein | - |
| ABFU22_RS05245 (ABFU22_05230) | - | 1240266..1240667 (-) | 402 | WP_076037054.1 | SymE family type I addiction module toxin | - |
| ABFU22_RS05250 (ABFU22_05235) | coaE | 1241199..1241822 (-) | 624 | WP_040940796.1 | dephospho-CoA kinase | - |
| ABFU22_RS05255 (ABFU22_05240) | - | 1241836..1242699 (-) | 864 | WP_057671659.1 | A24 family peptidase | - |
| ABFU22_RS05260 (ABFU22_05245) | pilC | 1242706..1243968 (-) | 1263 | WP_057671824.1 | type II secretion system F family protein | Machinery gene |
| ABFU22_RS05265 (ABFU22_05250) | pilA | 1244310..1244738 (+) | 429 | WP_057671660.1 | pilin | Machinery gene |
| ABFU22_RS05270 (ABFU22_05255) | pilB | 1244874..1246604 (+) | 1731 | WP_274375747.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU22_RS05275 (ABFU22_05260) | - | 1246787..1247002 (-) | 216 | WP_274375533.1 | hypothetical protein | - |
| ABFU22_RS05280 (ABFU22_05265) | - | 1247084..1247524 (-) | 441 | WP_274375534.1 | hypothetical protein | - |
| ABFU22_RS05285 (ABFU22_05270) | - | 1247524..1247886 (-) | 363 | WP_217694196.1 | hypothetical protein | - |
| ABFU22_RS05290 (ABFU22_05275) | pilR | 1248078..1249472 (-) | 1395 | WP_043921909.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU22_RS05295 (ABFU22_05280) | - | 1249681..1251291 (-) | 1611 | WP_011038210.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU22_RS05300 (ABFU22_05285) | sucC | 1251525..1252694 (+) | 1170 | WP_012437609.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU22_RS05305 (ABFU22_05290) | sucD | 1252719..1253594 (+) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU22_RS05310 (ABFU22_05295) | - | 1253698..1254108 (+) | 411 | WP_029628876.1 | CopG family ribbon-helix-helix protein | - |
| ABFU22_RS05315 (ABFU22_05300) | - | 1254112..1254414 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 14272.35 Da Isoelectric Point: 9.1206
>NTDB_id=1000056 ABFU22_RS05265 WP_057671660.1 1244310..1244738(+) (pilA) [Xanthomonas campestris pv. campestris strain 0483]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
Nucleotide
Download Length: 429 bp
>NTDB_id=1000056 ABFU22_RS05265 WP_057671660.1 1244310..1244738(+) (pilA) [Xanthomonas campestris pv. campestris strain 0483]
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA | Ralstonia pseudosolanacearum GMI1000 |
52.201 |
100 |
0.585 |
| pilA2 | Legionella pneumophila str. Paris |
54.795 |
100 |
0.563 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
54.795 |
100 |
0.563 |
| comP | Acinetobacter baylyi ADP1 |
47.771 |
100 |
0.528 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
39.247 |
100 |
0.514 |
| pilA/pilA1 | Eikenella corrodens VA1 |
40 |
100 |
0.437 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.541 |
100 |
0.423 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
40.136 |
100 |
0.415 |
| pilA | Acinetobacter baumannii strain A118 |
40.426 |
99.296 |
0.401 |
| pilA | Vibrio cholerae C6706 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae strain A1552 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
33.766 |
100 |
0.366 |