Detailed information
Bioinformatically predicted
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | ABFU09_RS05395 | Genome accession | NZ_CP155934 |
| Coordinates | 1280126..1280554 (+) | Length | 142 a.a. |
| NCBI ID | WP_057671660.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain Xc02 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1233279..1289175 | 1280126..1280554 | within | 0 |
Gene organization within MGE regions
Location: 1233279..1289175
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU09_RS05180 (ABFU09_05170) | - | 1233279..1235159 (+) | 1881 | WP_019237331.1 | integrase arm-type DNA-binding domain-containing protein | - |
| ABFU09_RS05185 (ABFU09_05175) | - | 1235344..1235763 (+) | 420 | WP_019237332.1 | hypothetical protein | - |
| ABFU09_RS05190 (ABFU09_05180) | - | 1235796..1236797 (+) | 1002 | WP_011038253.1 | XVIPCD domain-containing protein | - |
| ABFU09_RS05195 (ABFU09_05185) | - | 1236868..1237518 (-) | 651 | WP_011038252.1 | LysR substrate-binding domain-containing protein | - |
| ABFU09_RS05200 (ABFU09_05190) | - | 1237621..1237914 (+) | 294 | WP_011038251.1 | helix-turn-helix domain-containing protein | - |
| ABFU09_RS05205 (ABFU09_05195) | - | 1237942..1238826 (-) | 885 | WP_057671621.1 | LysR family transcriptional regulator | - |
| ABFU09_RS05210 (ABFU09_05200) | - | 1239579..1243604 (-) | 4026 | WP_075287146.1 | helix-turn-helix domain-containing protein | - |
| ABFU09_RS05215 (ABFU09_05205) | - | 1244152..1247415 (-) | 3264 | WP_057671623.1 | ATP-binding protein | - |
| ABFU09_RS05220 (ABFU09_05210) | - | 1247506..1247637 (+) | 132 | Protein_1008 | IS5/IS1182 family transposase | - |
| ABFU09_RS05225 (ABFU09_05215) | - | 1248606..1250144 (+) | 1539 | WP_289362753.1 | MASE1 domain-containing protein | - |
| ABFU09_RS05230 (ABFU09_05220) | - | 1251166..1251813 (+) | 648 | WP_016848927.1 | hypothetical protein | - |
| ABFU09_RS05235 (ABFU09_05225) | - | 1251845..1252984 (+) | 1140 | WP_017117946.1 | type IV secretion system protein | - |
| ABFU09_RS05240 (ABFU09_05230) | - | 1253062..1253601 (+) | 540 | WP_225443876.1 | DUF4189 domain-containing protein | - |
| ABFU09_RS05245 (ABFU09_05235) | - | 1253999..1254529 (+) | 531 | WP_011038239.1 | hypothetical protein | - |
| ABFU09_RS05250 (ABFU09_05240) | - | 1254526..1255185 (+) | 660 | WP_057671625.1 | hypothetical protein | - |
| ABFU09_RS05255 (ABFU09_05245) | - | 1255182..1256564 (+) | 1383 | WP_057671628.1 | DUF6792 domain-containing protein | - |
| ABFU09_RS05260 (ABFU09_05250) | - | 1256668..1257095 (+) | 428 | Protein_1016 | type IV secretion system protein | - |
| ABFU09_RS05265 (ABFU09_05255) | - | 1257604..1258748 (+) | 1145 | WP_274349786.1 | IS3 family transposase | - |
| ABFU09_RS05270 (ABFU09_05260) | - | 1259297..1259776 (+) | 480 | WP_075286085.1 | RadC family protein | - |
| ABFU09_RS05275 (ABFU09_05265) | - | 1259847..1260038 (+) | 192 | WP_221261829.1 | hypothetical protein | - |
| ABFU09_RS05280 (ABFU09_05270) | - | 1260411..1260827 (+) | 417 | WP_147309009.1 | hypothetical protein | - |
| ABFU09_RS05285 (ABFU09_05275) | - | 1261816..1262241 (+) | 426 | Protein_1021 | XVIPCD domain-containing protein | - |
| ABFU09_RS05290 (ABFU09_05280) | - | 1262269..1262523 (-) | 255 | WP_057671639.1 | hypothetical protein | - |
| ABFU09_RS05295 (ABFU09_05285) | - | 1262790..1264385 (+) | 1596 | WP_192012501.1 | MobA/MobL family protein | - |
| ABFU09_RS05300 (ABFU09_05290) | - | 1264458..1264826 (-) | 369 | WP_225443877.1 | transcriptional regulator | - |
| ABFU09_RS05305 (ABFU09_05295) | - | 1264834..1265115 (-) | 282 | WP_011348355.1 | DUF6516 family protein | - |
| ABFU09_RS05310 (ABFU09_05300) | - | 1265181..1265522 (-) | 342 | WP_081020748.1 | hypothetical protein | - |
| ABFU09_RS05315 (ABFU09_05305) | - | 1266248..1266598 (+) | 351 | WP_225443878.1 | hypothetical protein | - |
| ABFU09_RS05320 (ABFU09_05310) | - | 1266897..1267127 (-) | 231 | WP_157382680.1 | hypothetical protein | - |
| ABFU09_RS05325 (ABFU09_05315) | - | 1267191..1267337 (+) | 147 | WP_040940792.1 | hypothetical protein | - |
| ABFU09_RS05330 (ABFU09_05320) | - | 1267522..1267917 (+) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU09_RS05335 (ABFU09_05325) | - | 1268008..1268400 (+) | 393 | WP_012437593.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU09_RS05340 (ABFU09_05330) | - | 1268515..1268865 (-) | 351 | WP_228415051.1 | hypothetical protein | - |
| ABFU09_RS05345 (ABFU09_05335) | glgX | 1268935..1271064 (-) | 2130 | WP_057671651.1 | glycogen debranching protein GlgX | - |
| ABFU09_RS05350 (ABFU09_05340) | rimK | 1271557..1272432 (+) | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU09_RS05355 (ABFU09_05345) | - | 1273082..1273759 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU09_RS05360 (ABFU09_05350) | - | 1273752..1275086 (+) | 1335 | WP_057671653.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU09_RS05365 (ABFU09_05355) | - | 1275229..1275732 (-) | 504 | WP_343124102.1 | GNAT family N-acetyltransferase | - |
| ABFU09_RS05370 (ABFU09_05360) | - | 1275717..1276007 (-) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ABFU09_RS05375 (ABFU09_05365) | - | 1276082..1276483 (-) | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| ABFU09_RS05380 (ABFU09_05370) | coaE | 1277015..1277638 (-) | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
| ABFU09_RS05385 (ABFU09_05375) | - | 1277652..1278515 (-) | 864 | WP_057671659.1 | A24 family peptidase | - |
| ABFU09_RS05390 (ABFU09_05380) | pilC | 1278522..1279784 (-) | 1263 | WP_057671824.1 | type II secretion system F family protein | Machinery gene |
| ABFU09_RS05395 (ABFU09_05385) | pilA | 1280126..1280554 (+) | 429 | WP_057671660.1 | pilin | Machinery gene |
| ABFU09_RS05400 (ABFU09_05390) | pilB | 1280690..1282420 (+) | 1731 | WP_057671826.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU09_RS05410 (ABFU09_05400) | pilR | 1282839..1284233 (-) | 1395 | WP_057671663.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU09_RS05415 (ABFU09_05405) | - | 1284442..1286052 (-) | 1611 | WP_057671664.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU09_RS05420 (ABFU09_05410) | sucC | 1286286..1287455 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU09_RS05425 (ABFU09_05415) | sucD | 1287480..1288355 (+) | 876 | WP_057671668.1 | succinate--CoA ligase subunit alpha | - |
| ABFU09_RS05430 (ABFU09_05420) | - | 1288459..1288869 (+) | 411 | WP_029217117.1 | CopG family ribbon-helix-helix protein | - |
| ABFU09_RS05435 (ABFU09_05425) | - | 1288873..1289175 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 14272.35 Da Isoelectric Point: 9.1206
>NTDB_id=999876 ABFU09_RS05395 WP_057671660.1 1280126..1280554(+) (pilA) [Xanthomonas campestris pv. campestris strain Xc02]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
Nucleotide
Download Length: 429 bp
>NTDB_id=999876 ABFU09_RS05395 WP_057671660.1 1280126..1280554(+) (pilA) [Xanthomonas campestris pv. campestris strain Xc02]
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA | Ralstonia pseudosolanacearum GMI1000 |
52.201 |
100 |
0.585 |
| pilA2 | Legionella pneumophila str. Paris |
54.795 |
100 |
0.563 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
54.795 |
100 |
0.563 |
| comP | Acinetobacter baylyi ADP1 |
47.771 |
100 |
0.528 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
39.247 |
100 |
0.514 |
| pilA/pilA1 | Eikenella corrodens VA1 |
40 |
100 |
0.437 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.541 |
100 |
0.423 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
40.136 |
100 |
0.415 |
| pilA | Acinetobacter baumannii strain A118 |
40.426 |
99.296 |
0.401 |
| pilA | Vibrio cholerae C6706 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae strain A1552 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
33.766 |
100 |
0.366 |