Detailed information
Bioinformatically predicted
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | ABFU18_RS05445 | Genome accession | NZ_CP155930 |
| Coordinates | 1286587..1287015 (+) | Length | 142 a.a. |
| NCBI ID | WP_057671660.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain CFBP 4954 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1262686..1318297 | 1286587..1287015 | within | 0 |
Gene organization within MGE regions
Location: 1262686..1318297
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU18_RS05315 (ABFU18_05315) | - | 1264065..1265209 (+) | 1145 | WP_274349786.1 | IS3 family transposase | - |
| ABFU18_RS05320 (ABFU18_05320) | - | 1265758..1266237 (+) | 480 | WP_075286085.1 | RadC family protein | - |
| ABFU18_RS05325 (ABFU18_05325) | - | 1266308..1266499 (+) | 192 | WP_221261829.1 | hypothetical protein | - |
| ABFU18_RS05330 (ABFU18_05330) | - | 1266872..1267288 (+) | 417 | WP_147309009.1 | hypothetical protein | - |
| ABFU18_RS05335 (ABFU18_05335) | - | 1268277..1268702 (+) | 426 | Protein_1033 | XVIPCD domain-containing protein | - |
| ABFU18_RS05340 (ABFU18_05340) | - | 1268730..1268984 (-) | 255 | WP_057671639.1 | hypothetical protein | - |
| ABFU18_RS05345 (ABFU18_05345) | - | 1269251..1270846 (+) | 1596 | WP_192012501.1 | MobA/MobL family protein | - |
| ABFU18_RS05350 (ABFU18_05350) | - | 1270919..1271287 (-) | 369 | WP_225443877.1 | transcriptional regulator | - |
| ABFU18_RS05355 (ABFU18_05355) | - | 1271295..1271576 (-) | 282 | WP_011348355.1 | DUF6516 family protein | - |
| ABFU18_RS05360 (ABFU18_05360) | - | 1271642..1271983 (-) | 342 | WP_081020748.1 | hypothetical protein | - |
| ABFU18_RS05365 (ABFU18_05365) | - | 1272709..1273059 (+) | 351 | WP_225443878.1 | hypothetical protein | - |
| ABFU18_RS05370 (ABFU18_05370) | - | 1273358..1273588 (-) | 231 | WP_157382680.1 | hypothetical protein | - |
| ABFU18_RS05375 (ABFU18_05375) | - | 1273652..1273798 (+) | 147 | WP_040940792.1 | hypothetical protein | - |
| ABFU18_RS05380 (ABFU18_05380) | - | 1273983..1274378 (+) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU18_RS05385 (ABFU18_05385) | - | 1274469..1274861 (+) | 393 | WP_012437593.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU18_RS05390 (ABFU18_05390) | - | 1274976..1275326 (-) | 351 | WP_228415051.1 | hypothetical protein | - |
| ABFU18_RS05395 (ABFU18_05395) | glgX | 1275396..1277525 (-) | 2130 | WP_057671651.1 | glycogen debranching protein GlgX | - |
| ABFU18_RS05400 (ABFU18_05400) | rimK | 1278018..1278893 (+) | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU18_RS05405 (ABFU18_05405) | - | 1279543..1280220 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU18_RS05410 (ABFU18_05410) | - | 1280213..1281547 (+) | 1335 | WP_057671653.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU18_RS05415 (ABFU18_05415) | - | 1281690..1282181 (-) | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | - |
| ABFU18_RS05420 (ABFU18_05420) | - | 1282178..1282468 (-) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ABFU18_RS05425 (ABFU18_05425) | - | 1282543..1282944 (-) | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| ABFU18_RS05430 (ABFU18_05430) | coaE | 1283476..1284099 (-) | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
| ABFU18_RS05435 (ABFU18_05435) | - | 1284113..1284976 (-) | 864 | WP_057671659.1 | A24 family peptidase | - |
| ABFU18_RS05440 (ABFU18_05440) | pilC | 1284983..1286245 (-) | 1263 | WP_057671824.1 | type II secretion system F family protein | Machinery gene |
| ABFU18_RS05445 (ABFU18_05445) | pilA | 1286587..1287015 (+) | 429 | WP_057671660.1 | pilin | Machinery gene |
| ABFU18_RS05450 (ABFU18_05450) | pilB | 1287151..1288881 (+) | 1731 | WP_057671826.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU18_RS05460 (ABFU18_05460) | pilR | 1289300..1290694 (-) | 1395 | WP_057671663.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU18_RS05465 (ABFU18_05465) | - | 1290903..1292513 (-) | 1611 | WP_057671664.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU18_RS05470 (ABFU18_05470) | sucC | 1292747..1293916 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU18_RS05475 (ABFU18_05475) | sucD | 1293941..1294816 (+) | 876 | WP_057671668.1 | succinate--CoA ligase subunit alpha | - |
| ABFU18_RS05480 (ABFU18_05480) | - | 1294920..1295330 (+) | 411 | WP_029217117.1 | CopG family ribbon-helix-helix protein | - |
| ABFU18_RS05485 (ABFU18_05485) | - | 1295334..1295636 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ABFU18_RS05490 (ABFU18_05490) | - | 1295636..1297291 (+) | 1656 | WP_057671669.1 | NAD+ synthase | - |
| ABFU18_RS05495 (ABFU18_05495) | - | 1297285..1298271 (-) | 987 | WP_057671671.1 | hypothetical protein | - |
| ABFU18_RS05500 (ABFU18_05500) | - | 1298723..1299604 (-) | 882 | WP_011038204.1 | outer membrane protein assembly factor BamD | - |
| ABFU18_RS05505 (ABFU18_05505) | rluD | 1299727..1300722 (+) | 996 | WP_057671673.1 | 23S rRNA pseudouridine(1911/1915/1917) synthase RluD | - |
| ABFU18_RS05510 (ABFU18_05510) | pgeF | 1300724..1301524 (+) | 801 | WP_050911331.1 | peptidoglycan editing factor PgeF | - |
| ABFU18_RS05515 (ABFU18_05515) | - | 1301545..1302042 (+) | 498 | WP_050911332.1 | DUF4166 domain-containing protein | - |
| ABFU18_RS05520 (ABFU18_05520) | - | 1302029..1302448 (+) | 420 | WP_012437616.1 | thiol-disulfide oxidoreductase DCC family protein | - |
| ABFU18_RS05525 (ABFU18_05525) | - | 1303084..1304952 (-) | 1869 | WP_040940808.1 | methyl-accepting chemotaxis protein | - |
| ABFU18_RS05530 (ABFU18_05530) | - | 1305484..1307919 (-) | 2436 | WP_029628877.1 | glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase | - |
| ABFU18_RS05535 (ABFU18_05535) | otsA | 1308870..1310237 (-) | 1368 | WP_011038197.1 | alpha,alpha-trehalose-phosphate synthase (UDP-forming) | - |
| ABFU18_RS05540 (ABFU18_05540) | - | 1310234..1312012 (-) | 1779 | WP_040940809.1 | glycoside hydrolase family 15 protein | - |
| ABFU18_RS05545 (ABFU18_05545) | otsB | 1312062..1312820 (-) | 759 | WP_068573934.1 | trehalose-phosphatase | - |
| ABFU18_RS05550 (ABFU18_05550) | - | 1313542..1315977 (-) | 2436 | WP_011038194.1 | TonB-dependent siderophore receptor | - |
| ABFU18_RS05555 (ABFU18_05555) | - | 1316182..1316655 (+) | 474 | WP_012437623.1 | DUF3574 domain-containing protein | - |
| ABFU18_RS05560 (ABFU18_05560) | - | 1316679..1317551 (+) | 873 | WP_050911334.1 | XAC2610-related protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 14272.35 Da Isoelectric Point: 9.1206
>NTDB_id=999805 ABFU18_RS05445 WP_057671660.1 1286587..1287015(+) (pilA) [Xanthomonas campestris pv. campestris strain CFBP 4954]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTVRGRVSEAMVAASAAKTVVAENAANGSALDSGWTAPTATNNVASVA
VATATGNITVTTTAKAGGGTIIFAPSANGAALASGTVPTDRISWDCKGGTLAAKYRPAECRT
Nucleotide
Download Length: 429 bp
>NTDB_id=999805 ABFU18_RS05445 WP_057671660.1 1286587..1287015(+) (pilA) [Xanthomonas campestris pv. campestris strain CFBP 4954]
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
ATGAAAAAGCAACAAGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCAATCCTTGCCGCCATCGCGCT
GCCGGCTTATCAGGACTACACCGTTCGCGGTCGTGTCTCTGAAGCAATGGTTGCTGCCTCTGCTGCCAAGACGGTTGTGG
CCGAGAATGCTGCGAACGGCTCCGCCCTAGACAGTGGTTGGACCGCTCCTACGGCAACTAACAATGTCGCCAGCGTCGCT
GTTGCTACCGCTACGGGCAATATCACTGTTACTACCACTGCCAAGGCCGGTGGCGGCACGATAATCTTTGCTCCCTCGGC
TAACGGTGCTGCACTGGCTTCCGGTACTGTTCCAACCGATCGTATTTCTTGGGATTGCAAGGGCGGCACCTTGGCTGCCA
AGTACCGTCCAGCTGAATGCCGCACCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA | Ralstonia pseudosolanacearum GMI1000 |
52.201 |
100 |
0.585 |
| pilA2 | Legionella pneumophila str. Paris |
54.795 |
100 |
0.563 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
54.795 |
100 |
0.563 |
| comP | Acinetobacter baylyi ADP1 |
47.771 |
100 |
0.528 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
39.247 |
100 |
0.514 |
| pilA/pilA1 | Eikenella corrodens VA1 |
40 |
100 |
0.437 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.541 |
100 |
0.423 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
40.136 |
100 |
0.415 |
| pilA | Acinetobacter baumannii strain A118 |
40.426 |
99.296 |
0.401 |
| pilA | Vibrio cholerae C6706 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae strain A1552 |
33.766 |
100 |
0.366 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
33.766 |
100 |
0.366 |