Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MGAS37832_RS05300 | Genome accession | NZ_CP151458 |
| Coordinates | 1037962..1038387 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37832 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1002703..1049013 | 1037962..1038387 | within | 0 |
Gene organization within MGE regions
Location: 1002703..1049013
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37832_RS05055 (MGAS37832_02082) | pfkA | 1002703..1003716 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS37832_RS05060 (MGAS37832_02084) | - | 1003796..1006906 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS37832_RS05065 (MGAS37832_02086) | - | 1007091..1007462 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS37832_RS05070 (MGAS37832_02088) | - | 1007462..1008160 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS37832_RS05075 (MGAS37832_02090) | - | 1008170..1008955 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS37832_RS05080 (MGAS37832_02092) | - | 1009082..1009696 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS37832_RS05090 (MGAS37832_02096) | prx | 1010287..1010475 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS37832_RS05095 (MGAS37832_02098) | speA | 1010695..1011450 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS37832_RS05100 (MGAS37832_02100) | - | 1011572..1012231 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS37832_RS05105 (MGAS37832_02102) | - | 1012231..1012452 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS37832_RS05110 (MGAS37832_02104) | - | 1012462..1013235 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS37832_RS05115 (MGAS37832_02106) | - | 1013246..1013848 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS37832_RS05120 (MGAS37832_02108) | - | 1013860..1014624 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS37832_RS05125 (MGAS37832_02110) | - | 1014626..1014958 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS37832_RS05130 (MGAS37832_02112) | - | 1014958..1015281 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS37832_RS05135 (MGAS37832_02114) | - | 1015295..1015417 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS37832_RS05140 (MGAS37832_02116) | - | 1015431..1015778 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS37832_RS05145 (MGAS37832_02118) | - | 1015789..1017651 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS37832_RS05150 (MGAS37832_02120) | - | 1017656..1021096 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS37832_RS05155 (MGAS37832_02122) | - | 1021097..1022581 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS37832_RS05160 (MGAS37832_02124) | - | 1022582..1024387 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS37832_RS05165 (MGAS37832_02126) | - | 1024380..1024838 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS37832_RS05170 (MGAS37832_02128) | - | 1024811..1025128 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS37832_RS05175 (MGAS37832_02130) | - | 1025141..1025647 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS37832_RS05180 (MGAS37832_02132) | - | 1025659..1026069 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS37832_RS05185 (MGAS37832_02134) | - | 1026071..1026466 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS37832_RS05190 (MGAS37832_02136) | - | 1026463..1026774 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS37832_RS05195 (MGAS37832_02138) | - | 1026771..1027115 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS37832_RS05200 (MGAS37832_02140) | - | 1027129..1027422 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS37832_RS05205 (MGAS37832_02142) | - | 1027435..1028325 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS37832_RS05210 (MGAS37832_02144) | - | 1028344..1028913 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS37832_RS05215 (MGAS37832_02146) | - | 1029022..1029156 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS37832_RS05220 (MGAS37832_02148) | - | 1029158..1029427 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS37832_RS05225 (MGAS37832_02150) | - | 1029434..1030342 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS37832_RS05230 (MGAS37832_02152) | - | 1030311..1031636 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS37832_RS05235 (MGAS37832_02154) | - | 1031636..1032910 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS37832_RS05240 (MGAS37832_02156) | - | 1032900..1033280 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS37832_RS05245 (MGAS37832_02158) | - | 1033890..1034324 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS37832_RS05250 (MGAS37832_02160) | - | 1034610..1034876 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS37832_RS05255 (MGAS37832_02162) | - | 1034873..1035397 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS37832_RS05260 (MGAS37832_02164) | - | 1035400..1036032 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS37832_RS05265 (MGAS37832_02166) | - | 1036034..1036318 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS37832_RS05270 (MGAS37832_02168) | - | 1036315..1036485 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS37832_RS05275 (MGAS37832_02170) | - | 1036482..1036718 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS37832_RS05280 (MGAS37832_02172) | - | 1036718..1036963 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS37832_RS05285 (MGAS37832_02174) | - | 1036960..1037316 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS37832_RS05290 (MGAS37832_02176) | - | 1037313..1037753 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS37832_RS05295 | - | 1037753..1037956 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS37832_RS05300 (MGAS37832_02178) | ssb | 1037962..1038387 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS37832_RS05305 (MGAS37832_02180) | - | 1038380..1039054 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS37832_RS05310 (MGAS37832_02182) | - | 1039055..1039537 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS37832_RS05315 (MGAS37832_02184) | - | 1039559..1039813 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS37832_RS05320 (MGAS37832_02186) | - | 1039794..1040147 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS37832_RS05325 (MGAS37832_02190) | - | 1040288..1041070 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS37832_RS05330 (MGAS37832_02192) | - | 1041057..1041887 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS37832_RS05335 | - | 1041901..1042089 (-) | 189 | Protein_999 | XRE family transcriptional regulator | - |
| MGAS37832_RS05340 | - | 1042323..1042562 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS37832_RS05345 (MGAS37832_02196) | - | 1042693..1042902 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS37832_RS05350 (MGAS37832_02198) | - | 1043012..1043212 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS37832_RS05355 (MGAS37832_02200) | - | 1043286..1043672 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS37832_RS05360 (MGAS37832_02202) | - | 1043661..1043870 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS37832_RS05365 (MGAS37832_02204) | - | 1043924..1044523 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS37832_RS05370 (MGAS37832_02206) | - | 1044553..1044711 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS37832_RS05375 (MGAS37832_02210) | - | 1045068..1045892 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37832_RS05380 (MGAS37832_02212) | - | 1045928..1046821 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS37832_RS05385 | - | 1046942..1048030 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS37832_RS05390 (MGAS37832_02218) | - | 1048393..1049013 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=977938 MGAS37832_RS05300 WP_011285575.1 1037962..1038387(-) (ssb) [Streptococcus pyogenes strain MGAS37832]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=977938 MGAS37832_RS05300 WP_011285575.1 1037962..1038387(-) (ssb) [Streptococcus pyogenes strain MGAS37832]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |