Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MGAS38337_RS05275 | Genome accession | NZ_CP151439 |
| Coordinates | 1035053..1035478 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS38337 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999794..1046104 | 1035053..1035478 | within | 0 |
Gene organization within MGE regions
Location: 999794..1046104
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS38337_RS05030 (MGAS38337_02072) | pfkA | 999794..1000807 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS38337_RS05035 (MGAS38337_02074) | - | 1000887..1003997 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS38337_RS05040 (MGAS38337_02076) | - | 1004182..1004553 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS38337_RS05045 (MGAS38337_02078) | - | 1004553..1005251 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS38337_RS05050 (MGAS38337_02080) | - | 1005261..1006046 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS38337_RS05055 (MGAS38337_02082) | - | 1006173..1006787 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS38337_RS05065 (MGAS38337_02086) | prx | 1007378..1007566 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS38337_RS05070 (MGAS38337_02088) | speA | 1007786..1008541 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS38337_RS05075 (MGAS38337_02090) | - | 1008663..1009322 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS38337_RS05080 (MGAS38337_02092) | - | 1009322..1009543 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS38337_RS05085 (MGAS38337_02094) | - | 1009553..1010326 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS38337_RS05090 (MGAS38337_02096) | - | 1010337..1010939 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS38337_RS05095 (MGAS38337_02098) | - | 1010951..1011715 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS38337_RS05100 (MGAS38337_02100) | - | 1011717..1012049 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS38337_RS05105 (MGAS38337_02102) | - | 1012049..1012372 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS38337_RS05110 (MGAS38337_02104) | - | 1012386..1012508 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS38337_RS05115 (MGAS38337_02106) | - | 1012522..1012869 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS38337_RS05120 (MGAS38337_02108) | - | 1012880..1014742 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS38337_RS05125 (MGAS38337_02110) | - | 1014747..1018187 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS38337_RS05130 (MGAS38337_02112) | - | 1018188..1019672 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS38337_RS05135 (MGAS38337_02114) | - | 1019673..1021478 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS38337_RS05140 (MGAS38337_02116) | - | 1021471..1021929 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS38337_RS05145 (MGAS38337_02118) | - | 1021902..1022219 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS38337_RS05150 (MGAS38337_02120) | - | 1022232..1022738 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS38337_RS05155 (MGAS38337_02122) | - | 1022750..1023160 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS38337_RS05160 (MGAS38337_02124) | - | 1023162..1023557 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS38337_RS05165 (MGAS38337_02126) | - | 1023554..1023865 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS38337_RS05170 (MGAS38337_02128) | - | 1023862..1024206 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS38337_RS05175 (MGAS38337_02130) | - | 1024220..1024513 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS38337_RS05180 (MGAS38337_02132) | - | 1024526..1025416 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS38337_RS05185 (MGAS38337_02134) | - | 1025435..1026004 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS38337_RS05190 (MGAS38337_02136) | - | 1026113..1026247 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS38337_RS05195 (MGAS38337_02138) | - | 1026249..1026518 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS38337_RS05200 (MGAS38337_02140) | - | 1026525..1027433 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS38337_RS05205 (MGAS38337_02142) | - | 1027402..1028727 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS38337_RS05210 (MGAS38337_02144) | - | 1028727..1030001 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS38337_RS05215 (MGAS38337_02146) | - | 1029991..1030371 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS38337_RS05220 (MGAS38337_02148) | - | 1030981..1031415 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS38337_RS05225 (MGAS38337_02150) | - | 1031701..1031967 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS38337_RS05230 (MGAS38337_02152) | - | 1031964..1032488 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS38337_RS05235 (MGAS38337_02154) | - | 1032491..1033123 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS38337_RS05240 (MGAS38337_02156) | - | 1033125..1033409 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS38337_RS05245 (MGAS38337_02158) | - | 1033406..1033576 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS38337_RS05250 (MGAS38337_02160) | - | 1033573..1033809 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS38337_RS05255 (MGAS38337_02162) | - | 1033809..1034054 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS38337_RS05260 (MGAS38337_02164) | - | 1034051..1034407 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS38337_RS05265 (MGAS38337_02166) | - | 1034404..1034844 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS38337_RS05270 | - | 1034844..1035047 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS38337_RS05275 (MGAS38337_02168) | ssb | 1035053..1035478 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS38337_RS05280 (MGAS38337_02170) | - | 1035471..1036145 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS38337_RS05285 (MGAS38337_02172) | - | 1036146..1036628 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS38337_RS05290 (MGAS38337_02174) | - | 1036650..1036904 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS38337_RS05295 (MGAS38337_02176) | - | 1036885..1037238 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS38337_RS05300 (MGAS38337_02180) | - | 1037379..1038161 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS38337_RS05305 (MGAS38337_02182) | - | 1038148..1038978 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS38337_RS05310 | - | 1038992..1039180 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| MGAS38337_RS05315 | - | 1039414..1039653 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS38337_RS05320 (MGAS38337_02186) | - | 1039784..1039993 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS38337_RS05325 (MGAS38337_02188) | - | 1040103..1040303 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS38337_RS05330 (MGAS38337_02190) | - | 1040377..1040763 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS38337_RS05335 (MGAS38337_02192) | - | 1040752..1040961 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS38337_RS05340 (MGAS38337_02194) | - | 1041015..1041614 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS38337_RS05345 (MGAS38337_02196) | - | 1041644..1041802 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS38337_RS05350 (MGAS38337_02200) | - | 1042159..1042983 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS38337_RS05355 (MGAS38337_02202) | - | 1043019..1043912 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS38337_RS05360 | - | 1044033..1045121 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS38337_RS05365 (MGAS38337_02208) | - | 1045484..1046104 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=976874 MGAS38337_RS05275 WP_011285575.1 1035053..1035478(-) (ssb) [Streptococcus pyogenes strain MGAS38337]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=976874 MGAS38337_RS05275 WP_011285575.1 1035053..1035478(-) (ssb) [Streptococcus pyogenes strain MGAS38337]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |