Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WN947_RS06105 | Genome accession | NZ_CP150491 |
| Coordinates | 1213711..1214103 (-) | Length | 130 a.a. |
| NCBI ID | WP_340701378.1 | Uniprot ID | - |
| Organism | Brevibacillus borstelensis strain S8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1171408..1230474 | 1213711..1214103 | within | 0 |
Gene organization within MGE regions
Location: 1171408..1230474
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WN947_RS05840 | - | 1171514..1171636 (-) | 123 | Protein_1144 | ATP-binding protein | - |
| WN947_RS05845 | - | 1171660..1172103 (+) | 444 | WP_340701340.1 | helix-turn-helix domain-containing protein | - |
| WN947_RS05850 | - | 1172164..1172841 (-) | 678 | WP_340701341.1 | SOS response-associated peptidase | - |
| WN947_RS05855 | - | 1172884..1173420 (-) | 537 | WP_340701342.1 | hypothetical protein | - |
| WN947_RS05860 | - | 1173501..1174307 (-) | 807 | WP_340701343.1 | phospholipase D family protein | - |
| WN947_RS05865 | - | 1174514..1175566 (-) | 1053 | WP_340701344.1 | hypothetical protein | - |
| WN947_RS05870 | - | 1175979..1177324 (+) | 1346 | WP_340701345.1 | IS3 family transposase | - |
| WN947_RS05875 | - | 1177401..1178207 (-) | 807 | WP_340701346.1 | DUF1906 domain-containing protein | - |
| WN947_RS05880 | - | 1178191..1178394 (-) | 204 | WP_340701347.1 | hypothetical protein | - |
| WN947_RS05885 | - | 1178396..1178590 (-) | 195 | WP_340701348.1 | BhlA/UviB family holin-like peptide | - |
| WN947_RS05890 | - | 1178699..1178842 (-) | 144 | WP_170208406.1 | CD1375 family protein | - |
| WN947_RS05895 | - | 1178886..1179014 (-) | 129 | WP_255320374.1 | CD1375 family protein | - |
| WN947_RS05900 | - | 1179011..1179220 (-) | 210 | WP_340701349.1 | hypothetical protein | - |
| WN947_RS05905 | - | 1179220..1182240 (-) | 3021 | WP_340701350.1 | hypothetical protein | - |
| WN947_RS05910 | - | 1182296..1182568 (-) | 273 | WP_340701351.1 | hypothetical protein | - |
| WN947_RS05915 | - | 1182569..1182889 (-) | 321 | WP_340701352.1 | hypothetical protein | - |
| WN947_RS05920 | - | 1182886..1183458 (-) | 573 | WP_031931962.1 | DUF2313 domain-containing protein | - |
| WN947_RS05925 | - | 1183455..1184270 (-) | 816 | WP_340701353.1 | baseplate J/gp47 family protein | - |
| WN947_RS05930 | - | 1184258..1184692 (-) | 435 | WP_340701354.1 | DUF2634 domain-containing protein | - |
| WN947_RS05935 | - | 1184693..1184941 (-) | 249 | WP_251255871.1 | hypothetical protein | - |
| WN947_RS05940 | - | 1184945..1185898 (-) | 954 | WP_340701355.1 | hypothetical protein | - |
| WN947_RS05945 | - | 1185911..1186504 (-) | 594 | WP_340701356.1 | hypothetical protein | - |
| WN947_RS05950 | - | 1186501..1188987 (-) | 2487 | WP_340701357.1 | hypothetical protein | - |
| WN947_RS05955 | - | 1189855..1190316 (-) | 462 | WP_003385945.1 | hypothetical protein | - |
| WN947_RS05960 | - | 1190328..1190780 (-) | 453 | WP_003385946.1 | hypothetical protein | - |
| WN947_RS05965 | - | 1190781..1192118 (-) | 1338 | WP_327955607.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| WN947_RS05970 | - | 1192121..1192315 (-) | 195 | WP_003385950.1 | hypothetical protein | - |
| WN947_RS05975 | - | 1192315..1192779 (-) | 465 | WP_003385951.1 | hypothetical protein | - |
| WN947_RS05980 | - | 1192779..1193261 (-) | 483 | WP_198291570.1 | HK97 gp10 family phage protein | - |
| WN947_RS05985 | - | 1193584..1193964 (-) | 381 | WP_003385954.1 | DUF3199 family protein | - |
| WN947_RS05990 | - | 1193930..1194172 (-) | 243 | WP_003385955.1 | hypothetical protein | - |
| WN947_RS05995 | - | 1194172..1195107 (-) | 936 | WP_003385956.1 | hypothetical protein | - |
| WN947_RS06000 | - | 1195122..1196147 (-) | 1026 | WP_003385958.1 | XkdF-like putative serine protease domain-containing protein | - |
| WN947_RS06005 | - | 1196169..1197017 (-) | 849 | WP_340701358.1 | phage minor head protein | - |
| WN947_RS06010 | - | 1196989..1198461 (-) | 1473 | WP_340701359.1 | phage portal protein | - |
| WN947_RS06015 | - | 1198465..1199916 (-) | 1452 | WP_340701360.1 | DEAD/DEAH box helicase family protein | - |
| WN947_RS06020 | - | 1199909..1200610 (-) | 702 | WP_340701361.1 | hypothetical protein | - |
| WN947_RS06025 | - | 1200857..1201588 (-) | 732 | WP_340701362.1 | DUF4145 domain-containing protein | - |
| WN947_RS06030 | - | 1201652..1201885 (-) | 234 | WP_340701363.1 | hypothetical protein | - |
| WN947_RS06035 | - | 1202022..1203317 (-) | 1296 | WP_340701364.1 | site-specific DNA-methyltransferase | - |
| WN947_RS06040 | - | 1203539..1204033 (-) | 495 | WP_340701365.1 | hypothetical protein | - |
| WN947_RS06045 | - | 1204084..1204656 (-) | 573 | WP_340701366.1 | GIY-YIG nuclease family protein | - |
| WN947_RS06050 | - | 1205373..1206215 (-) | 843 | WP_340701367.1 | DUF2971 domain-containing protein | - |
| WN947_RS06055 | - | 1206423..1206812 (-) | 390 | WP_340701368.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| WN947_RS06060 | - | 1206909..1208078 (-) | 1170 | WP_340701369.1 | XRE family transcriptional regulator | - |
| WN947_RS06065 | - | 1208108..1208881 (-) | 774 | WP_340701370.1 | DUF5986 family protein | - |
| WN947_RS06070 | - | 1209067..1209285 (+) | 219 | WP_340701371.1 | hypothetical protein | - |
| WN947_RS06075 | - | 1209289..1209444 (-) | 156 | WP_340701372.1 | hypothetical protein | - |
| WN947_RS06080 | - | 1209475..1210197 (-) | 723 | WP_340701373.1 | hypothetical protein | - |
| WN947_RS06085 | - | 1210219..1210692 (-) | 474 | WP_340701374.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WN947_RS06090 | dnaB | 1210752..1212137 (-) | 1386 | WP_340701375.1 | replicative DNA helicase | - |
| WN947_RS06095 | - | 1212134..1213117 (-) | 984 | WP_340701376.1 | hypothetical protein | - |
| WN947_RS06100 | - | 1213300..1213698 (-) | 399 | WP_340701377.1 | hypothetical protein | - |
| WN947_RS06105 | ssbA | 1213711..1214103 (-) | 393 | WP_340701378.1 | single-stranded DNA-binding protein | Machinery gene |
| WN947_RS06110 | - | 1214104..1214748 (-) | 645 | WP_340701379.1 | ERF family protein | - |
| WN947_RS06115 | - | 1214745..1215320 (-) | 576 | WP_340701380.1 | host-nuclease inhibitor Gam family protein | - |
| WN947_RS06125 | - | 1215622..1215894 (-) | 273 | WP_340701381.1 | hypothetical protein | - |
| WN947_RS06130 | - | 1215959..1216105 (-) | 147 | WP_340701382.1 | hypothetical protein | - |
| WN947_RS06135 | - | 1216102..1216458 (-) | 357 | WP_340701383.1 | hypothetical protein | - |
| WN947_RS06140 | - | 1216451..1217005 (-) | 555 | WP_340701384.1 | helix-turn-helix transcriptional regulator | - |
| WN947_RS06145 | - | 1217461..1217619 (-) | 159 | WP_340701385.1 | hypothetical protein | - |
| WN947_RS06150 | - | 1217633..1217878 (-) | 246 | WP_340701386.1 | helix-turn-helix transcriptional regulator | - |
| WN947_RS06155 | - | 1218024..1218404 (+) | 381 | WP_340701590.1 | helix-turn-helix transcriptional regulator | - |
| WN947_RS06160 | - | 1218457..1218918 (+) | 462 | WP_340701387.1 | hypothetical protein | - |
| WN947_RS06170 | - | 1220682..1222700 (+) | 2019 | WP_340701389.1 | ATP-binding protein | - |
| WN947_RS06175 | dgt | 1223026..1224357 (-) | 1332 | WP_340701390.1 | dGTP triphosphohydrolase | - |
| WN947_RS06180 | - | 1224543..1225355 (-) | 813 | WP_340701391.1 | hypothetical protein | - |
| WN947_RS06185 | - | 1225360..1226562 (-) | 1203 | WP_340701392.1 | HNH endonuclease | - |
| WN947_RS06190 | - | 1226721..1227113 (-) | 393 | WP_340701393.1 | hypothetical protein | - |
| WN947_RS06195 | - | 1227328..1228191 (-) | 864 | WP_340701394.1 | DUF5071 domain-containing protein | - |
| WN947_RS06200 | - | 1228318..1228800 (+) | 483 | WP_340701395.1 | ImmA/IrrE family metallo-endopeptidase | - |
| WN947_RS06205 | - | 1228837..1230474 (+) | 1638 | WP_340701396.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14802.83 Da Isoelectric Point: 6.9302
>NTDB_id=970643 WN947_RS06105 WP_340701378.1 1213711..1214103(-) (ssbA) [Brevibacillus borstelensis strain S8]
MNKVILIGHLARDPEMRYTPNAIAVTTFTLAVNRPKSKDGMEQQPDWINCVVWQKTAENCANYLRKGSKVLVEGRIQTRS
FDDKEGKKRYVTEVVGENVQFLSPKNQGEKPDEPCPPREPINISDDDLPF
MNKVILIGHLARDPEMRYTPNAIAVTTFTLAVNRPKSKDGMEQQPDWINCVVWQKTAENCANYLRKGSKVLVEGRIQTRS
FDDKEGKKRYVTEVVGENVQFLSPKNQGEKPDEPCPPREPINISDDDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=970643 WN947_RS06105 WP_340701378.1 1213711..1214103(-) (ssbA) [Brevibacillus borstelensis strain S8]
TTGAACAAAGTCATTTTGATTGGTCACCTCGCTCGCGACCCAGAGATGAGATACACGCCCAACGCCATTGCGGTTACCAC
CTTCACGCTCGCTGTTAACCGCCCCAAGTCAAAAGACGGGATGGAACAGCAACCGGACTGGATCAACTGTGTTGTATGGC
AGAAAACGGCTGAGAATTGTGCCAACTATCTTCGGAAGGGAAGCAAGGTACTGGTGGAGGGGCGGATTCAAACTCGATCT
TTCGACGACAAAGAAGGGAAGAAGAGGTACGTTACTGAGGTTGTTGGAGAGAACGTACAATTTCTGTCGCCAAAGAACCA
AGGGGAGAAGCCAGATGAGCCGTGCCCACCAAGAGAGCCAATCAACATCAGTGATGATGATCTTCCGTTTTGA
TTGAACAAAGTCATTTTGATTGGTCACCTCGCTCGCGACCCAGAGATGAGATACACGCCCAACGCCATTGCGGTTACCAC
CTTCACGCTCGCTGTTAACCGCCCCAAGTCAAAAGACGGGATGGAACAGCAACCGGACTGGATCAACTGTGTTGTATGGC
AGAAAACGGCTGAGAATTGTGCCAACTATCTTCGGAAGGGAAGCAAGGTACTGGTGGAGGGGCGGATTCAAACTCGATCT
TTCGACGACAAAGAAGGGAAGAAGAGGTACGTTACTGAGGTTGTTGGAGAGAACGTACAATTTCTGTCGCCAAAGAACCA
AGGGGAGAAGCCAGATGAGCCGTGCCCACCAAGAGAGCCAATCAACATCAGTGATGATGATCTTCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
42.105 |
100 |
0.554 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
37.278 |
100 |
0.485 |
| ssb | Vibrio cholerae strain A1552 |
34.884 |
100 |
0.462 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
48.214 |
86.154 |
0.415 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.221 |
100 |
0.415 |
| ssbA | Streptococcus mutans UA159 |
41.221 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.923 |
100 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.923 |
100 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.154 |
100 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.154 |
100 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.154 |
100 |
0.362 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.154 |
100 |
0.362 |