Detailed information NTG0940406

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: V6U63_RS09285
• Genome accession: NZ_CP145861
• Coordinates: 1998419..1998745 (-)
• Length: 108 a.a.
• NCBI ID: WP_002885815.1
• Uniprot ID: -
• Organism: Streptococcus salivarius strain KSS3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1993419..2003745

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V6U63_RS09245 (V6U63_09230)	-	1993683..1994339 (-)	657	WP_410535064.1	CPBP family intramembrane glutamic endopeptidase	-
V6U63_RS09250 (V6U63_09235)	-	1994351..1994548 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
V6U63_RS09255 (V6U63_09240)	-	1994799..1995992 (-)	1194	WP_410535066.1	acetate kinase	-
V6U63_RS09260 (V6U63_09245)	comYH	1996049..1997005 (-)	957	WP_227071975.1	class I SAM-dependent methyltransferase	Machinery gene
V6U63_RS09265 (V6U63_09250)	comGG	1997050..1997367 (-)	318	WP_227071976.1	competence type IV pilus minor pilin ComGG	-
V6U63_RS09270 (V6U63_09255)	comYF	1997345..1997782 (-)	438	WP_227071977.1	competence type IV pilus minor pilin ComGF	Machinery gene
V6U63_RS09275 (V6U63_09260)	comGE	1997769..1997999 (-)	231	WP_021144685.1	competence type IV pilus minor pilin ComGE	-
V6U63_RS09280 (V6U63_09265)	comYD	1998031..1998459 (-)	429	WP_253183813.1	competence type IV pilus minor pilin ComGD	Machinery gene
V6U63_RS09285 (V6U63_09270)	comYC	1998419..1998745 (-)	327	WP_002885815.1	competence type IV pilus major pilin ComGC	Machinery gene
V6U63_RS09290 (V6U63_09275)	comYB	1998742..1999842 (-)	1101	WP_144429890.1	competence type IV pilus assembly protein ComGB	Machinery gene
V6U63_RS09295 (V6U63_09280)	comYA	1999724..2000665 (-)	942	WP_002885658.1	competence type IV pilus ATPase ComGA	Machinery gene
V6U63_RS09300 (V6U63_09285)	-	2000747..2001109 (-)	363	WP_002887019.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11932.03 Da
• Isoelectric Point: 9.9219

>NTDB_id=940406 V6U63_RS09285 WP_002885815.1 1998419..1998745(-) (comYC) [Streptococcus salivarius strain KSS3]
MKMMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=940406 V6U63_RS09285 WP_002885815.1 1998419..1998745(-) (comYC) [Streptococcus salivarius strain KSS3]
ATGAAAATGATGTTAAAAAAATTGAATGCCGTTAAACTACGAGCTTTTACACTAATCGAAATGCTGGTCGTGCTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTG
TGGTCAAGGTCGTGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCA
GAAGGTCAAATCACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361