Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLL8_RS04275 | Genome accession | NZ_AP025700 |
| Coordinates | 863090..863524 (+) | Length | 144 a.a. |
| NCBI ID | WP_251900320.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain L8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 856749..905854 | 863090..863524 | within | 0 |
Gene organization within MGE regions
Location: 856749..905854
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLL8_RS04220 (LLL8_08060) | - | 856749..857879 (-) | 1131 | WP_251900309.1 | site-specific integrase | - |
| LLL8_RS04225 (LLL8_08070) | - | 858010..858711 (-) | 702 | WP_251900311.1 | hypothetical protein | - |
| LLL8_RS04230 (LLL8_08080) | - | 858858..859028 (+) | 171 | WP_251900312.1 | hypothetical protein | - |
| LLL8_RS04235 (LLL8_08090) | - | 859012..859896 (-) | 885 | WP_251900313.1 | hypothetical protein | - |
| LLL8_RS04240 (LLL8_08100) | - | 859954..860541 (-) | 588 | WP_251900314.1 | hypothetical protein | - |
| LLL8_RS12285 | - | 860552..860815 (-) | 264 | WP_350028259.1 | hypothetical protein | - |
| LLL8_RS12290 | - | 860864..861061 (-) | 198 | Protein_810 | helix-turn-helix transcriptional regulator | - |
| LLL8_RS04250 (LLL8_08120) | - | 861262..861489 (+) | 228 | WP_033900181.1 | hypothetical protein | - |
| LLL8_RS04255 (LLL8_08130) | - | 861514..862239 (+) | 726 | WP_251900316.1 | ORF6C domain-containing protein | - |
| LLL8_RS04260 (LLL8_08140) | - | 862379..862630 (+) | 252 | WP_033900176.1 | hypothetical protein | - |
| LLL8_RS04265 (LLL8_08150) | - | 862718..862882 (+) | 165 | WP_251900317.1 | hypothetical protein | - |
| LLL8_RS04270 (LLL8_08160) | - | 862879..863100 (+) | 222 | WP_251900318.1 | hypothetical protein | - |
| LLL8_RS04275 (LLL8_08170) | ssb | 863090..863524 (+) | 435 | WP_251900320.1 | single-stranded DNA-binding protein | Machinery gene |
| LLL8_RS04280 (LLL8_08180) | - | 863535..864431 (+) | 897 | WP_251900321.1 | phage replisome organiser protein | - |
| LLL8_RS04285 (LLL8_08190) | - | 864424..864816 (+) | 393 | WP_251900322.1 | hypothetical protein | - |
| LLL8_RS04290 (LLL8_08200) | - | 864835..865035 (+) | 201 | WP_195918835.1 | hypothetical protein | - |
| LLL8_RS04295 (LLL8_08210) | - | 865032..865286 (+) | 255 | WP_195918834.1 | DUF1031 family protein | - |
| LLL8_RS04300 (LLL8_08230) | - | 865414..865650 (+) | 237 | WP_195918833.1 | hypothetical protein | - |
| LLL8_RS04305 (LLL8_08240) | - | 865650..865823 (+) | 174 | WP_251900323.1 | hypothetical protein | - |
| LLL8_RS04310 (LLL8_08250) | dcm | 865820..867331 (+) | 1512 | WP_251900324.1 | DNA (cytosine-5-)-methyltransferase | - |
| LLL8_RS04315 (LLL8_08260) | - | 867400..867666 (+) | 267 | WP_195918956.1 | hypothetical protein | - |
| LLL8_RS04320 (LLL8_08270) | - | 867663..867857 (+) | 195 | WP_251900325.1 | DUF1660 domain-containing protein | - |
| LLL8_RS04325 (LLL8_08280) | - | 867890..868282 (+) | 393 | WP_251900326.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLL8_RS04330 (LLL8_08290) | - | 868400..868744 (+) | 345 | WP_251900327.1 | hypothetical protein | - |
| LLL8_RS04335 (LLL8_08300) | - | 868790..869134 (+) | 345 | WP_251900328.1 | hypothetical protein | - |
| LLL8_RS04340 (LLL8_08310) | - | 869251..869565 (+) | 315 | WP_251900329.1 | hypothetical protein | - |
| LLL8_RS04345 (LLL8_08320) | - | 869642..869941 (+) | 300 | WP_039116109.1 | hypothetical protein | - |
| LLL8_RS04350 (LLL8_08330) | - | 869990..870289 (+) | 300 | WP_251900330.1 | HNH endonuclease | - |
| LLL8_RS04355 (LLL8_08340) | - | 870430..871023 (+) | 594 | WP_251900331.1 | helix-turn-helix transcriptional regulator | - |
| LLL8_RS04360 (LLL8_08350) | - | 871020..872759 (+) | 1740 | WP_180350364.1 | terminase large subunit | - |
| LLL8_RS04365 (LLL8_08360) | - | 872951..874144 (+) | 1194 | WP_227150006.1 | phage portal protein | - |
| LLL8_RS04370 (LLL8_08370) | - | 874131..874916 (+) | 786 | WP_058210168.1 | head maturation protease, ClpP-related | - |
| LLL8_RS04375 (LLL8_08380) | - | 874916..876043 (+) | 1128 | WP_227150005.1 | phage major capsid protein | - |
| LLL8_RS04380 (LLL8_08390) | - | 876104..876361 (+) | 258 | WP_227150004.1 | hypothetical protein | - |
| LLL8_RS04385 (LLL8_08400) | - | 876379..876711 (+) | 333 | WP_058210171.1 | hypothetical protein | - |
| LLL8_RS04390 (LLL8_08410) | - | 876677..877063 (+) | 387 | WP_227150003.1 | phage head-tail adapter protein | - |
| LLL8_RS04395 (LLL8_08420) | - | 877056..877460 (+) | 405 | WP_227150002.1 | HK97 gp10 family phage protein | - |
| LLL8_RS04400 (LLL8_08430) | - | 877457..877846 (+) | 390 | WP_227150001.1 | hypothetical protein | - |
| LLL8_RS04405 (LLL8_08440) | - | 877861..878442 (+) | 582 | WP_227150000.1 | major tail protein | - |
| LLL8_RS04410 (LLL8_08450) | - | 878508..878813 (+) | 306 | WP_227149999.1 | hypothetical protein | - |
| LLL8_RS12240 (LLL8_08460) | - | 878894..879016 (+) | 123 | WP_255217742.1 | hypothetical protein | - |
| LLL8_RS04415 (LLL8_08470) | - | 879117..879914 (+) | 798 | WP_227149998.1 | FxLYD domain-containing protein | - |
| LLL8_RS04420 (LLL8_08480) | - | 880024..883995 (+) | 3972 | WP_227149997.1 | phage tail tape measure protein | - |
| LLL8_RS04425 (LLL8_08490) | - | 883992..885632 (+) | 1641 | WP_251900332.1 | distal tail protein Dit | - |
| LLL8_RS04430 (LLL8_08500) | - | 885632..889021 (+) | 3390 | WP_227149995.1 | phage tail spike protein | - |
| LLL8_RS04435 (LLL8_08510) | - | 889033..889263 (+) | 231 | WP_227149994.1 | hypothetical protein | - |
| LLL8_RS04440 (LLL8_08520) | - | 889276..889692 (+) | 417 | WP_227149993.1 | phage holin family protein | - |
| LLL8_RS04445 (LLL8_08530) | - | 889689..890036 (+) | 348 | WP_227149992.1 | phage holin | - |
| LLL8_RS04450 (LLL8_08540) | - | 890033..890764 (+) | 732 | WP_227149991.1 | peptidoglycan amidohydrolase family protein | - |
| LLL8_RS04455 (LLL8_08550) | - | 890794..891135 (-) | 342 | WP_227149990.1 | MmcQ/YjbR family DNA-binding protein | - |
| LLL8_RS04460 (LLL8_08560) | - | 891289..891951 (+) | 663 | WP_251900333.1 | hypothetical protein | - |
| LLL8_RS04465 (LLL8_08570) | - | 891941..893071 (+) | 1131 | WP_227149988.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LLL8_RS04470 (LLL8_08580) | - | 894184..894384 (+) | 201 | WP_014570681.1 | cold-shock protein | - |
| LLL8_RS04475 (LLL8_08590) | - | 894941..895375 (+) | 435 | WP_227149987.1 | YfbU family protein | - |
| LLL8_RS04480 (LLL8_08600) | - | 895969..896478 (+) | 510 | WP_033900119.1 | hypothetical protein | - |
| LLL8_RS04485 (LLL8_08610) | - | 896471..897799 (+) | 1329 | WP_033900116.1 | glycosyltransferase family 2 protein | - |
| LLL8_RS04490 (LLL8_08620) | - | 898027..898563 (+) | 537 | WP_010905603.1 | HdeD family acid-resistance protein | - |
| LLL8_RS04495 (LLL8_08630) | pnuC | 898760..899491 (+) | 732 | WP_058203634.1 | nicotinamide riboside transporter PnuC | - |
| LLL8_RS04500 (LLL8_08640) | - | 899606..899761 (-) | 156 | WP_003131383.1 | hypothetical protein | - |
| LLL8_RS04505 (LLL8_08650) | - | 900019..900444 (+) | 426 | WP_058203635.1 | universal stress protein | - |
| LLL8_RS04510 (LLL8_08660) | - | 900566..900913 (+) | 348 | WP_058203636.1 | HU family DNA-binding protein | - |
| LLL8_RS04515 (LLL8_08670) | - | 900981..901514 (-) | 534 | WP_003131387.1 | TetR/AcrR family transcriptional regulator | - |
| LLL8_RS04520 (LLL8_08680) | - | 901678..904077 (+) | 2400 | WP_251900334.1 | YhgE/Pip domain-containing protein | - |
| LLL8_RS04525 (LLL8_08690) | - | 904263..904595 (+) | 333 | WP_003131392.1 | metal-sulfur cluster assembly factor | - |
| LLL8_RS04530 (LLL8_08700) | - | 905075..905854 (-) | 780 | WP_017864372.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 16207.89 Da Isoelectric Point: 4.7294
>NTDB_id=93683 LLL8_RS04275 WP_251900320.1 863090..863524(+) (ssb) [Lactococcus lactis strain L8]
MINNVVLVGRITRDPELRYTPQQNQAVATFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGALIGVTGRIQT
RSYENQQGQRVYITEVVADSFQMLESKGGTKQNEESQNNTAPNFARNDSNDIPGTEISDDDLPF
MINNVVLVGRITRDPELRYTPQQNQAVATFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGALIGVTGRIQT
RSYENQQGQRVYITEVVADSFQMLESKGGTKQNEESQNNTAPNFARNDSNDIPGTEISDDDLPF
Nucleotide
Download Length: 435 bp
>NTDB_id=93683 LLL8_RS04275 WP_251900320.1 863090..863524(+) (ssb) [Lactococcus lactis strain L8]
ATGATAAATAACGTTGTACTAGTTGGACGTATTACACGAGATCCAGAATTAAGATATACACCACAACAAAATCAGGCAGT
TGCAACTTTCAGTTTGGCTGTTAATCGTCAATTTAAGAACGCAAACGGAGAACGTGAAGCAGACTTCATAAATTGCGTTA
TCTGGCGTCAACAAGCCGAAAATTTAGCAAATTGGGCTAAAAAAGGGGCTTTGATTGGAGTAACTGGCAGAATCCAAACA
CGAAGTTATGAAAATCAGCAAGGACAACGAGTCTACATCACAGAAGTAGTTGCTGACAGTTTTCAAATGCTGGAAAGCAA
AGGCGGAACAAAGCAAAATGAAGAGTCACAAAATAATACAGCTCCGAATTTTGCGCGTAATGATTCCAATGATATTCCAG
GCACAGAAATTAGTGATGATGATTTGCCATTTTAG
ATGATAAATAACGTTGTACTAGTTGGACGTATTACACGAGATCCAGAATTAAGATATACACCACAACAAAATCAGGCAGT
TGCAACTTTCAGTTTGGCTGTTAATCGTCAATTTAAGAACGCAAACGGAGAACGTGAAGCAGACTTCATAAATTGCGTTA
TCTGGCGTCAACAAGCCGAAAATTTAGCAAATTGGGCTAAAAAAGGGGCTTTGATTGGAGTAACTGGCAGAATCCAAACA
CGAAGTTATGAAAATCAGCAAGGACAACGAGTCTACATCACAGAAGTAGTTGCTGACAGTTTTCAAATGCTGGAAAGCAA
AGGCGGAACAAAGCAAAATGAAGAGTCACAAAATAATACAGCTCCGAATTTTGCGCGTAATGATTCCAATGATATTCCAG
GCACAGAAATTAGTGATGATGATTTGCCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.335 |
100 |
0.653 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.542 |
100 |
0.646 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.879 |
74.306 |
0.438 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.056 |
100 |
0.431 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.361 |
100 |
0.424 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.667 |
100 |
0.417 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.667 |
100 |
0.417 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.667 |
100 |
0.417 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.667 |
100 |
0.417 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.667 |
100 |
0.417 |
| ssbA | Streptococcus mutans UA159 |
38.889 |
100 |
0.389 |
| ssb | Neisseria meningitidis MC58 |
31.034 |
100 |
0.375 |