NTDB

Overview

Name	pilE	Type	Machinery gene
Locus tag	V5F96_RS09395	Genome accession	NZ_CP145059
Coordinates	1787913..1788197 (+)	Length	94 a.a.
NCBI ID	WP_144998599.1	Uniprot ID	-
Organism	Neisseria gonorrhoeae strain WHO_W_2024
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1782913..1793197

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V5F96_RS09365 (V5F96_09375)	-	1783409..1783765 (+)	357	Protein_1822	pilin	-
V5F96_RS09370 (V5F96_09380)	-	1784292..1784690 (+)	399	Protein_1823	pilin	-
V5F96_RS09375 (V5F96_09390)	lpxC	1785404..1786327 (+)	924	WP_003687007.1	UDP-3-O-acyl-N-acetylglucosamine deacetylase	-
V5F96_RS09380 (V5F96_09395)	-	1786462..1786857 (+)	396	Protein_1825	pilin	-
V5F96_RS09385 (V5F96_09400)	-	1786980..1787098 (+)	119	Protein_1826	pilin	-
V5F96_RS09390 (V5F96_09405)	-	1787401..1787544 (+)	144	WP_050171221.1	hypothetical protein	-
V5F96_RS09395 (V5F96_09410)	pilE	1787913..1788197 (+)	285	WP_144998599.1	pilin	Machinery gene
V5F96_RS09400 (V5F96_09415)	-	1788765..1789541 (+)	777	Protein_1829	opacity family porin	-
V5F96_RS09405 (V5F96_09420)	-	1789555..1789770 (+)	216	WP_169300636.1	hypothetical protein	-
V5F96_RS09410 (V5F96_09425)	pilA	1789806..1791059 (-)	1254	WP_003696286.1	signal recognition particle-docking protein FtsY	Machinery gene
V5F96_RS09415 (V5F96_09430)	msrAB	1791205..1792773 (+)	1569	WP_003694393.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-

Sequence

Protein

Download Length: 94 a.a. Molecular weight: 10117.49 Da Isoelectric Point: 4.6094

                                >NTDB_id=936675 V5F96_RS09395 WP_144998599.1 1787913..1788197(+) (pilE) [Neisseria gonorrhoeae strain WHO_W_2024]

MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNNGKWPADNGAAGKDTTNIDT

KHLPSTCRDNFDAT

Nucleotide

Download Length: 285 bp

                                >NTDB_id=936675 V5F96_RS09395 WP_144998599.1 1787913..1788197(+) (pilE) [Neisseria gonorrhoeae strain WHO_W_2024]

ATGAATACCCTTCAAAAAGGCTTTACCCTTATCGAGCTGATGATTGTGATCGCCATCGTCGGCATTTTGGCGGCAGTCGC

CCTTCCCGCCTACCAAGACTACACCGCCCGCGCGCAAGTTTCCGAAGCCATCCTTTTGGCCGAAGGTCAAAAATCAGCCG

TTACCGAGTATTACCTGAATAACGGCAAATGGCCCGCCGACAACGGCGCTGCCGGCAAAGACACCACCAACATCGACACC

AAGCACCTGCCGTCAACCTGCCGCGATAACTTTGATGCCACCTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(36-75)

Prokaryotic N-terminal methylation motif (N_methyl)

(5-28)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilE	Neisseria gonorrhoeae MS11	85.185	86.17	0.734
pilE	Neisseria gonorrhoeae strain FA1090	93.056	76.596	0.713
pilA2	Legionella pneumophila strain ERS1305867	61.765	72.34	0.447
pilA2	Legionella pneumophila str. Paris	61.765	72.34	0.447
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	66.129	65.957	0.436
comP	Acinetobacter baylyi ADP1	67.241	61.702	0.415
pilA	Ralstonia pseudosolanacearum GMI1000	66.667	60.638	0.404
pilA	Pseudomonas aeruginosa PAK	47.5	85.106	0.404
pilA/pilAI	Pseudomonas stutzeri DSM 10701	59.375	68.085	0.404
pilA/pilA1	Eikenella corrodens VA1	56.923	69.149	0.394
pilA	Acinetobacter nosocomialis M2	68	53.191	0.362
pilA	Glaesserella parasuis strain SC1401	40.476	89.362	0.362

Detailed information NTG0936675