Detailed information NTG0926164

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: VP459_RS13460
• Genome accession: NZ_CP142600
• Coordinates: 2749380..2749691 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain M19060305
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2744380..2754691

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
VP459_RS13430 (VP459_13435)	-	2745163..2745366 (+)	204	WP_000087561.1	YqgQ family protein	-
VP459_RS13435 (VP459_13440)	-	2745363..2746349 (+)	987	WP_000161315.1	ROK family glucokinase	-
VP459_RS13440 (VP459_13445)	-	2746349..2746678 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
VP459_RS13445 (VP459_13450)	-	2746675..2747298 (+)	624	WP_001223006.1	MBL fold metallo-hydrolase	-
VP459_RS13450 (VP459_13455)	comGA	2747350..2748324 (+)	975	WP_000697215.1	competence type IV pilus ATPase ComGA	Machinery gene
VP459_RS13455 (VP459_13460)	comGB	2748296..2749366 (+)	1071	WP_000776403.1	competence type IV pilus assembly protein ComGB	Machinery gene
VP459_RS13460 (VP459_13465)	comGC	2749380..2749691 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
VP459_RS13465 (VP459_13470)	comGD	2749669..2750115 (+)	447	WP_075583651.1	competence type IV pilus minor pilin ComGD	Machinery gene
VP459_RS13470 (VP459_13475)	comGE	2750102..2750401 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
VP459_RS13475 (VP459_13480)	comGF	2750319..2750816 (+)	498	WP_029697681.1	competence type IV pilus minor pilin ComGF	Machinery gene
VP459_RS13480 (VP459_13485)	-	2750913..2751059 (+)	147	WP_001789879.1	hypothetical protein	-
VP459_RS13485 (VP459_13490)	-	2751049..2751573 (+)	525	WP_001015122.1	shikimate kinase	-
VP459_RS13490 (VP459_13495)	gcvT	2751732..2752823 (+)	1092	WP_000093355.1	glycine cleavage system aminomethyltransferase GcvT	-
VP459_RS13495 (VP459_13500)	gcvPA	2752843..2754189 (+)	1347	WP_000019688.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=926164 VP459_RS13460 WP_000472256.1 2749380..2749691(+) (comGC) [Staphylococcus aureus strain M19060305]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=926164 VP459_RS13460 WP_000472256.1 2749380..2749691(+) (comGC) [Staphylococcus aureus strain M19060305]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369