Detailed information NTG0921701

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: VRA41_RS08625
• Genome accession: NZ_CP142105
• Coordinates: 1651498..1651824 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain SCB0351
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1646498..1656824

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
VRA41_RS08585 (VRA41_08585)	-	1646765..1647190 (-)	426	WP_041827107.1	CPBP family intramembrane glutamic endopeptidase	-
VRA41_RS08590 (VRA41_08590)	-	1647433..1647630 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
VRA41_RS08595 (VRA41_08595)	-	1647879..1649072 (-)	1194	WP_022096898.1	acetate kinase	-
VRA41_RS08600 (VRA41_08600)	comYH	1649128..1650084 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
VRA41_RS08605 (VRA41_08605)	comGG	1650129..1650446 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
VRA41_RS08610 (VRA41_08610)	comYF	1650424..1650861 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
VRA41_RS08615 (VRA41_08615)	comGE	1650845..1651138 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
VRA41_RS08620 (VRA41_08620)	comYD	1651110..1651538 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
VRA41_RS08625 (VRA41_08625)	comYC	1651498..1651824 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
VRA41_RS08630 (VRA41_08630)	comYB	1651821..1652921 (-)	1101	WP_148148889.1	competence type IV pilus assembly protein ComGB	Machinery gene
VRA41_RS08635 (VRA41_08635)	comGA/cglA/cilD	1652803..1653744 (-)	942	WP_011226629.1	competence type IV pilus ATPase ComGA	Machinery gene
VRA41_RS08640 (VRA41_08640)	-	1653825..1654187 (-)	363	WP_011226630.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=921701 VRA41_RS08625 WP_002946126.1 1651498..1651824(-) (comYC) [Streptococcus thermophilus strain SCB0351]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=921701 VRA41_RS08625 WP_002946126.1 1651498..1651824(-) (comYC) [Streptococcus thermophilus strain SCB0351]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTAGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATATAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361