Detailed information NTG0921699

Bioinformatically predicted

Overview

• Name: comYF
• Type: Machinery gene
• Locus tag: VRA41_RS08610
• Genome accession: NZ_CP142105
• Coordinates: 1650424..1650861 (-)
• Length: 145 a.a.
• NCBI ID: WP_014608742.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain SCB0351
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1645424..1655861

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
VRA41_RS08575 (VRA41_08575)	-	1645478..1646140 (-)	663	WP_011227583.1	CPBP family intramembrane glutamic endopeptidase	-
VRA41_RS08580 (VRA41_08580)	-	1646243..1646691 (-)	449	Protein_1642	CAAX protease	-
VRA41_RS08585 (VRA41_08585)	-	1646765..1647190 (-)	426	WP_041827107.1	CPBP family intramembrane glutamic endopeptidase	-
VRA41_RS08590 (VRA41_08590)	-	1647433..1647630 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
VRA41_RS08595 (VRA41_08595)	-	1647879..1649072 (-)	1194	WP_022096898.1	acetate kinase	-
VRA41_RS08600 (VRA41_08600)	comYH	1649128..1650084 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
VRA41_RS08605 (VRA41_08605)	comGG	1650129..1650446 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
VRA41_RS08610 (VRA41_08610)	comYF	1650424..1650861 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
VRA41_RS08615 (VRA41_08615)	comGE	1650845..1651138 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
VRA41_RS08620 (VRA41_08620)	comYD	1651110..1651538 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
VRA41_RS08625 (VRA41_08625)	comYC	1651498..1651824 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
VRA41_RS08630 (VRA41_08630)	comYB	1651821..1652921 (-)	1101	WP_148148889.1	competence type IV pilus assembly protein ComGB	Machinery gene
VRA41_RS08635 (VRA41_08635)	comGA/cglA/cilD	1652803..1653744 (-)	942	WP_011226629.1	competence type IV pilus ATPase ComGA	Machinery gene
VRA41_RS08640 (VRA41_08640)	-	1653825..1654187 (-)	363	WP_011226630.1	DUF1033 family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16505.05 Da
• Isoelectric Point: 8.9784

>NTDB_id=921699 VRA41_RS08610 WP_014608742.1 1650424..1650861(-) (comYF) [Streptococcus thermophilus strain SCB0351]
MYLSSKLRAFTLLECLVALLVIAGSVQVYQGLTTVLVSNVKQVRQQENQDWLLFVQQMEAELEGCQLVKVEWNKLYVKKD
NQDLAFGLSSASDFRKTNADGRGYQPMLFDVKSSKVSQKNQIVTIQVTLKNELQRSFVYAFEKTG

Nucleotide

• Length: 438 bp

>NTDB_id=921699 VRA41_RS08610 WP_014608742.1 1650424..1650861(-) (comYF) [Streptococcus thermophilus strain SCB0351]
ATGTATCTAAGCAGTAAGCTGCGTGCCTTTACCCTCTTGGAATGTCTAGTGGCCTTGTTGGTCATTGCTGGCTCAGTTCA
AGTTTATCAAGGGTTAACCACTGTACTTGTGAGTAATGTTAAGCAGGTAAGACAACAAGAAAACCAAGATTGGCTTCTAT
TTGTTCAACAAATGGAGGCAGAATTAGAAGGATGTCAGTTGGTCAAGGTAGAGTGGAACAAACTCTATGTCAAGAAGGAT
AATCAAGACTTGGCTTTTGGTCTTTCAAGTGCCTCTGATTTTCGAAAAACAAATGCTGATGGTCGAGGTTATCAACCAAT
GCTTTTCGATGTCAAATCTAGTAAGGTAAGTCAAAAGAACCAGATAGTTACCATCCAAGTGACTCTTAAAAATGAACTAC
AAAGGAGTTTTGTTTATGCTTTTGAAAAAACAGGTTAG

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (39-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYF	Streptococcus mutans UA140	58.865	97.241	0.572
comYF	Streptococcus mutans UA159	58.156	97.241	0.566
comGF/cglF	Streptococcus pneumoniae D39	47.857	96.552	0.462
comGF/cglF	Streptococcus pneumoniae Rx1	47.857	96.552	0.462
comGF/cglF	Streptococcus pneumoniae R6	47.857	96.552	0.462
comGF/cglF	Streptococcus pneumoniae TIGR4	47.857	96.552	0.462
comGF/cglF	Streptococcus mitis NCTC 12261	46.099	97.241	0.448
comGF/cglF	Streptococcus mitis SK321	45.39	97.241	0.441
comGF	Lactococcus lactis subsp. cremoris KW2	46.043	95.862	0.441