Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | U2W45_RS05255 | Genome accession | NZ_CP140117 |
| Coordinates | 1034936..1035361 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999677..1045987 | 1034936..1035361 | within | 0 |
Gene organization within MGE regions
Location: 999677..1045987
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W45_RS05010 (U2W45_05005) | pfkA | 999677..1000690 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| U2W45_RS05015 (U2W45_05010) | - | 1000770..1003880 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| U2W45_RS05020 (U2W45_05015) | - | 1004065..1004436 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| U2W45_RS05025 (U2W45_05020) | - | 1004436..1005134 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| U2W45_RS05030 (U2W45_05025) | - | 1005144..1005929 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| U2W45_RS05035 (U2W45_05030) | - | 1006056..1006670 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| U2W45_RS05045 (U2W45_05040) | prx | 1007261..1007449 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| U2W45_RS05050 (U2W45_05045) | speA | 1007669..1008424 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| U2W45_RS05055 (U2W45_05050) | - | 1008546..1009205 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| U2W45_RS05060 (U2W45_05055) | - | 1009205..1009426 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| U2W45_RS05065 (U2W45_05060) | - | 1009436..1010209 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| U2W45_RS05070 (U2W45_05065) | - | 1010220..1010822 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| U2W45_RS05075 (U2W45_05070) | - | 1010834..1011598 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| U2W45_RS05080 (U2W45_05075) | - | 1011600..1011932 (-) | 333 | WP_011285562.1 | phage holin | - |
| U2W45_RS05085 (U2W45_05080) | - | 1011932..1012255 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| U2W45_RS05090 (U2W45_05085) | - | 1012269..1012391 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| U2W45_RS05095 (U2W45_05090) | - | 1012405..1012752 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| U2W45_RS05100 (U2W45_05095) | - | 1012763..1014625 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| U2W45_RS05105 (U2W45_05100) | - | 1014630..1018070 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| U2W45_RS05110 (U2W45_05105) | - | 1018071..1019555 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| U2W45_RS05115 (U2W45_05110) | - | 1019556..1021361 (-) | 1806 | WP_011054802.1 | tail protein | - |
| U2W45_RS05120 (U2W45_05115) | - | 1021354..1021812 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| U2W45_RS05125 (U2W45_05120) | - | 1021785..1022102 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| U2W45_RS05130 (U2W45_05125) | - | 1022115..1022621 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| U2W45_RS05135 (U2W45_05130) | - | 1022633..1023043 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| U2W45_RS05140 (U2W45_05135) | - | 1023045..1023440 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| U2W45_RS05145 (U2W45_05140) | - | 1023437..1023748 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| U2W45_RS05150 (U2W45_05145) | - | 1023745..1024089 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| U2W45_RS05155 (U2W45_05150) | - | 1024103..1024396 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| U2W45_RS05160 (U2W45_05155) | - | 1024409..1025299 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| U2W45_RS05165 (U2W45_05160) | - | 1025318..1025887 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| U2W45_RS05170 (U2W45_05165) | - | 1025996..1026130 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| U2W45_RS05175 (U2W45_05170) | - | 1026132..1026401 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| U2W45_RS05180 (U2W45_05175) | - | 1026408..1027316 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| U2W45_RS05185 (U2W45_05180) | - | 1027285..1028610 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| U2W45_RS05190 (U2W45_05185) | - | 1028610..1029884 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| U2W45_RS05195 (U2W45_05190) | - | 1029874..1030254 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| U2W45_RS05200 (U2W45_05195) | - | 1030864..1031298 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| U2W45_RS05205 (U2W45_05200) | - | 1031584..1031850 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| U2W45_RS05210 (U2W45_05205) | - | 1031847..1032371 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| U2W45_RS05215 (U2W45_05210) | - | 1032374..1033006 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| U2W45_RS05220 (U2W45_05215) | - | 1033008..1033292 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| U2W45_RS05225 (U2W45_05220) | - | 1033289..1033459 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| U2W45_RS05230 (U2W45_05225) | - | 1033456..1033692 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| U2W45_RS05235 (U2W45_05230) | - | 1033692..1033937 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| U2W45_RS05240 (U2W45_05235) | - | 1033934..1034290 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| U2W45_RS05245 (U2W45_05240) | - | 1034287..1034727 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| U2W45_RS05250 (U2W45_05245) | - | 1034727..1034930 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| U2W45_RS05255 (U2W45_05250) | ssb | 1034936..1035361 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| U2W45_RS05260 (U2W45_05255) | - | 1035354..1036028 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| U2W45_RS05265 (U2W45_05260) | - | 1036029..1036511 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| U2W45_RS05270 (U2W45_05265) | - | 1036533..1036787 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| U2W45_RS05275 (U2W45_05270) | - | 1036768..1037121 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| U2W45_RS05280 (U2W45_05275) | - | 1037262..1038044 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| U2W45_RS05285 (U2W45_05280) | - | 1038031..1038861 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| U2W45_RS05290 (U2W45_05285) | - | 1038875..1039063 (-) | 189 | Protein_996 | XRE family transcriptional regulator | - |
| U2W45_RS05295 (U2W45_05290) | - | 1039297..1039536 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| U2W45_RS05300 (U2W45_05295) | - | 1039667..1039876 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| U2W45_RS05305 (U2W45_05300) | - | 1039986..1040186 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| U2W45_RS05310 (U2W45_05305) | - | 1040260..1040646 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| U2W45_RS05315 (U2W45_05310) | - | 1040635..1040844 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| U2W45_RS05320 (U2W45_05315) | - | 1040898..1041497 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| U2W45_RS05325 (U2W45_05320) | - | 1041527..1041685 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| U2W45_RS05330 (U2W45_05325) | - | 1042042..1042866 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| U2W45_RS05335 (U2W45_05330) | - | 1042902..1043795 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| U2W45_RS05340 (U2W45_05335) | - | 1043916..1045004 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| U2W45_RS05345 (U2W45_05340) | - | 1045367..1045987 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=912832 U2W45_RS05255 WP_011285575.1 1034936..1035361(-) (ssb) [Streptococcus pyogenes strain NV1]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=912832 U2W45_RS05255 WP_011285575.1 1034936..1035361(-) (ssb) [Streptococcus pyogenes strain NV1]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |