Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | U2W41_RS05250 | Genome accession | NZ_CP140113 |
| Coordinates | 1032710..1033135 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV28 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 997451..1043761 | 1032710..1033135 | within | 0 |
Gene organization within MGE regions
Location: 997451..1043761
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W41_RS05005 (U2W41_05005) | pfkA | 997451..998464 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| U2W41_RS05010 (U2W41_05010) | - | 998544..1001654 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| U2W41_RS05015 (U2W41_05015) | - | 1001839..1002210 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| U2W41_RS05020 (U2W41_05020) | - | 1002210..1002908 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| U2W41_RS05025 (U2W41_05025) | - | 1002918..1003703 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| U2W41_RS05030 (U2W41_05030) | - | 1003830..1004444 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| U2W41_RS05040 (U2W41_05040) | prx | 1005035..1005223 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| U2W41_RS05045 (U2W41_05045) | speA | 1005443..1006198 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| U2W41_RS05050 (U2W41_05050) | - | 1006320..1006979 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| U2W41_RS05055 (U2W41_05055) | - | 1006979..1007200 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| U2W41_RS05060 (U2W41_05060) | - | 1007210..1007983 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| U2W41_RS05065 (U2W41_05065) | - | 1007994..1008596 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| U2W41_RS05070 (U2W41_05070) | - | 1008608..1009372 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| U2W41_RS05075 (U2W41_05075) | - | 1009374..1009706 (-) | 333 | WP_011285562.1 | phage holin | - |
| U2W41_RS05080 (U2W41_05080) | - | 1009706..1010029 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| U2W41_RS05085 (U2W41_05085) | - | 1010043..1010165 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| U2W41_RS05090 (U2W41_05090) | - | 1010179..1010526 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| U2W41_RS05095 (U2W41_05095) | - | 1010537..1012399 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| U2W41_RS05100 (U2W41_05100) | - | 1012404..1015844 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| U2W41_RS05105 (U2W41_05105) | - | 1015845..1017329 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| U2W41_RS05110 (U2W41_05110) | - | 1017330..1019135 (-) | 1806 | WP_011054802.1 | tail protein | - |
| U2W41_RS05115 (U2W41_05115) | - | 1019128..1019586 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| U2W41_RS05120 (U2W41_05120) | - | 1019559..1019876 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| U2W41_RS05125 (U2W41_05125) | - | 1019889..1020395 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| U2W41_RS05130 (U2W41_05130) | - | 1020407..1020817 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| U2W41_RS05135 (U2W41_05135) | - | 1020819..1021214 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| U2W41_RS05140 (U2W41_05140) | - | 1021211..1021522 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| U2W41_RS05145 (U2W41_05145) | - | 1021519..1021863 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| U2W41_RS05150 (U2W41_05150) | - | 1021877..1022170 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| U2W41_RS05155 (U2W41_05155) | - | 1022183..1023073 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| U2W41_RS05160 (U2W41_05160) | - | 1023092..1023661 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| U2W41_RS05165 (U2W41_05165) | - | 1023770..1023904 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| U2W41_RS05170 (U2W41_05170) | - | 1023906..1024175 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| U2W41_RS05175 (U2W41_05175) | - | 1024182..1025090 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| U2W41_RS05180 (U2W41_05180) | - | 1025059..1026384 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| U2W41_RS05185 (U2W41_05185) | - | 1026384..1027658 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| U2W41_RS05190 (U2W41_05190) | - | 1027648..1028028 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| U2W41_RS05195 (U2W41_05195) | - | 1028638..1029072 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| U2W41_RS05200 (U2W41_05200) | - | 1029358..1029624 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| U2W41_RS05205 (U2W41_05205) | - | 1029621..1030145 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| U2W41_RS05210 (U2W41_05210) | - | 1030148..1030780 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| U2W41_RS05215 (U2W41_05215) | - | 1030782..1031066 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| U2W41_RS05220 (U2W41_05220) | - | 1031063..1031233 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| U2W41_RS05225 (U2W41_05225) | - | 1031230..1031466 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| U2W41_RS05230 (U2W41_05230) | - | 1031466..1031711 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| U2W41_RS05235 (U2W41_05235) | - | 1031708..1032064 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| U2W41_RS05240 (U2W41_05240) | - | 1032061..1032501 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| U2W41_RS05245 (U2W41_05245) | - | 1032501..1032704 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| U2W41_RS05250 (U2W41_05250) | ssb | 1032710..1033135 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| U2W41_RS05255 (U2W41_05255) | - | 1033128..1033802 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| U2W41_RS05260 (U2W41_05260) | - | 1033803..1034285 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| U2W41_RS05265 (U2W41_05265) | - | 1034307..1034561 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| U2W41_RS05270 (U2W41_05270) | - | 1034542..1034895 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| U2W41_RS05275 (U2W41_05275) | - | 1035036..1035818 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| U2W41_RS05280 (U2W41_05280) | - | 1035805..1036635 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| U2W41_RS05285 (U2W41_05285) | - | 1036649..1036837 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| U2W41_RS05290 (U2W41_05290) | - | 1037071..1037310 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| U2W41_RS05295 (U2W41_05295) | - | 1037441..1037650 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| U2W41_RS05300 (U2W41_05300) | - | 1037760..1037960 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| U2W41_RS05305 (U2W41_05305) | - | 1038034..1038420 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| U2W41_RS05310 (U2W41_05310) | - | 1038409..1038618 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| U2W41_RS05315 (U2W41_05315) | - | 1038672..1039271 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| U2W41_RS05320 (U2W41_05320) | - | 1039301..1039459 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| U2W41_RS05325 (U2W41_05325) | - | 1039816..1040640 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| U2W41_RS05330 (U2W41_05330) | - | 1040676..1041569 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| U2W41_RS05335 (U2W41_05335) | - | 1041690..1042778 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| U2W41_RS05340 (U2W41_05340) | - | 1043141..1043761 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=912664 U2W41_RS05250 WP_011285575.1 1032710..1033135(-) (ssb) [Streptococcus pyogenes strain NV28]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=912664 U2W41_RS05250 WP_011285575.1 1032710..1033135(-) (ssb) [Streptococcus pyogenes strain NV28]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |