Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | U0N78_RS09640 | Genome accession | NZ_CP140109 |
| Coordinates | 2041055..2041471 (-) | Length | 138 a.a. |
| NCBI ID | WP_174850415.1 | Uniprot ID | A0A7T1P6E8 |
| Organism | Streptococcus suis strain 2022WUSS148 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2019953..2053350 | 2041055..2041471 | within | 0 |
Gene organization within MGE regions
Location: 2019953..2053350
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U0N78_RS09505 (U0N78_09505) | - | 2019953..2020357 (-) | 405 | WP_024399138.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| U0N78_RS09510 (U0N78_09510) | - | 2020418..2020603 (-) | 186 | WP_029185622.1 | type II toxin-antitoxin system HicA family toxin | - |
| U0N78_RS09515 (U0N78_09515) | - | 2020786..2022207 (-) | 1422 | WP_043026720.1 | peptidoglycan amidohydrolase family protein | - |
| U0N78_RS09520 (U0N78_09520) | - | 2022295..2022540 (-) | 246 | WP_029172929.1 | phage holin | - |
| U0N78_RS09525 (U0N78_09525) | - | 2022544..2022969 (-) | 426 | WP_029172930.1 | hypothetical protein | - |
| U0N78_RS09530 (U0N78_09530) | - | 2022973..2023218 (-) | 246 | WP_029172931.1 | hypothetical protein | - |
| U0N78_RS09535 (U0N78_09535) | - | 2023221..2023433 (-) | 213 | WP_061631527.1 | hypothetical protein | - |
| U0N78_RS09540 (U0N78_09540) | - | 2023442..2026588 (-) | 3147 | WP_322471668.1 | phage tail spike protein | - |
| U0N78_RS09545 (U0N78_09545) | - | 2026589..2027311 (-) | 723 | WP_172045804.1 | phage tail protein | - |
| U0N78_RS09550 (U0N78_09550) | - | 2027308..2030112 (-) | 2805 | WP_043024730.1 | phage tail tape measure protein | - |
| U0N78_RS09555 (U0N78_09555) | - | 2030301..2030774 (-) | 474 | WP_256769141.1 | hypothetical protein | - |
| U0N78_RS09560 (U0N78_09560) | - | 2030774..2031466 (-) | 693 | WP_043024728.1 | phage tail protein | - |
| U0N78_RS09565 (U0N78_09565) | - | 2031481..2031825 (-) | 345 | WP_043024727.1 | hypothetical protein | - |
| U0N78_RS09570 (U0N78_09570) | - | 2031812..2032159 (-) | 348 | WP_256769140.1 | hypothetical protein | - |
| U0N78_RS09575 (U0N78_09575) | - | 2032159..2032464 (-) | 306 | WP_043024725.1 | phage head closure protein | - |
| U0N78_RS09580 (U0N78_09580) | - | 2032461..2032796 (-) | 336 | WP_043024724.1 | hypothetical protein | - |
| U0N78_RS09585 (U0N78_09585) | - | 2032818..2034080 (-) | 1263 | WP_172073075.1 | phage major capsid protein | - |
| U0N78_RS09590 (U0N78_09590) | - | 2034093..2034635 (-) | 543 | WP_024398435.1 | HK97 family phage prohead protease | - |
| U0N78_RS09595 (U0N78_09595) | - | 2034686..2035828 (-) | 1143 | Protein_1856 | phage portal protein | - |
| U0N78_RS09600 (U0N78_09600) | - | 2035837..2037474 (-) | 1638 | WP_231640485.1 | terminase TerL endonuclease subunit | - |
| U0N78_RS09605 (U0N78_09605) | - | 2037542..2038027 (-) | 486 | WP_052496988.1 | hypothetical protein | - |
| U0N78_RS09610 (U0N78_09610) | - | 2038115..2038477 (-) | 363 | WP_174850416.1 | HNH endonuclease | - |
| U0N78_RS09615 (U0N78_09615) | - | 2038902..2039444 (-) | 543 | WP_043024721.1 | site-specific integrase | - |
| U0N78_RS09620 (U0N78_09620) | - | 2039556..2040020 (-) | 465 | WP_043024720.1 | hypothetical protein | - |
| U0N78_RS09625 (U0N78_09625) | - | 2039986..2040231 (-) | 246 | WP_024398442.1 | hypothetical protein | - |
| U0N78_RS09630 (U0N78_09630) | - | 2040200..2040334 (-) | 135 | WP_269434359.1 | hypothetical protein | - |
| U0N78_RS09635 (U0N78_09635) | - | 2040525..2040791 (-) | 267 | WP_043024718.1 | hypothetical protein | - |
| U0N78_RS09640 (U0N78_09640) | ssb | 2041055..2041471 (-) | 417 | WP_174850415.1 | single-stranded DNA-binding protein | Machinery gene |
| U0N78_RS09645 (U0N78_09645) | - | 2041475..2041738 (-) | 264 | WP_043024715.1 | helix-turn-helix domain-containing protein | - |
| U0N78_RS09650 (U0N78_09650) | - | 2041747..2042205 (-) | 459 | WP_043024714.1 | class I SAM-dependent methyltransferase | - |
| U0N78_RS09655 (U0N78_09655) | - | 2042333..2042554 (-) | 222 | WP_043024713.1 | hypothetical protein | - |
| U0N78_RS09660 (U0N78_09660) | - | 2042547..2042900 (-) | 354 | WP_197315057.1 | YopX family protein | - |
| U0N78_RS09665 (U0N78_09665) | - | 2042884..2043063 (-) | 180 | WP_043027195.1 | hypothetical protein | - |
| U0N78_RS09670 (U0N78_09670) | - | 2043063..2043635 (-) | 573 | WP_061844414.1 | DUF1642 domain-containing protein | - |
| U0N78_RS09675 (U0N78_09675) | - | 2043628..2043984 (-) | 357 | WP_043027197.1 | hypothetical protein | - |
| U0N78_RS09680 (U0N78_09680) | - | 2043989..2044306 (-) | 318 | WP_043025578.1 | hypothetical protein | - |
| U0N78_RS09685 (U0N78_09685) | - | 2044317..2044991 (-) | 675 | WP_043025580.1 | DNA methyltransferase | - |
| U0N78_RS09690 (U0N78_09690) | - | 2045044..2045109 (-) | 66 | Protein_1875 | DNA cytosine methyltransferase | - |
| U0N78_RS09695 (U0N78_09695) | - | 2045230..2045403 (-) | 174 | WP_162841075.1 | hypothetical protein | - |
| U0N78_RS09700 (U0N78_09700) | - | 2045390..2045827 (-) | 438 | WP_043025581.1 | hypothetical protein | - |
| U0N78_RS09705 (U0N78_09705) | - | 2045891..2046058 (-) | 168 | WP_153308617.1 | hypothetical protein | - |
| U0N78_RS09710 (U0N78_09710) | - | 2046058..2046276 (-) | 219 | WP_043025582.1 | hypothetical protein | - |
| U0N78_RS09715 (U0N78_09715) | - | 2046264..2047064 (-) | 801 | WP_024376892.1 | phage replisome organizer N-terminal domain-containing protein | - |
| U0N78_RS09720 (U0N78_09720) | - | 2047048..2047212 (-) | 165 | WP_197315058.1 | hypothetical protein | - |
| U0N78_RS09725 (U0N78_09725) | - | 2047227..2047481 (-) | 255 | WP_172045802.1 | hypothetical protein | - |
| U0N78_RS09730 (U0N78_09730) | - | 2047483..2047671 (-) | 189 | WP_172045801.1 | hypothetical protein | - |
| U0N78_RS09735 (U0N78_09735) | - | 2047668..2047952 (-) | 285 | WP_043025587.1 | hypothetical protein | - |
| U0N78_RS09740 (U0N78_09740) | - | 2048013..2048477 (-) | 465 | WP_043025589.1 | hypothetical protein | - |
| U0N78_RS09745 (U0N78_09745) | - | 2048541..2049248 (-) | 708 | WP_172073135.1 | ORF6C domain-containing protein | - |
| U0N78_RS09750 (U0N78_09750) | - | 2049302..2049733 (+) | 432 | WP_029178370.1 | hypothetical protein | - |
| U0N78_RS09755 (U0N78_09755) | - | 2049886..2050020 (-) | 135 | WP_256769127.1 | hypothetical protein | - |
| U0N78_RS09760 (U0N78_09760) | - | 2050013..2050210 (-) | 198 | WP_024405319.1 | hypothetical protein | - |
| U0N78_RS09765 (U0N78_09765) | - | 2050215..2050427 (-) | 213 | WP_043025601.1 | transcriptional regulator | - |
| U0N78_RS09770 (U0N78_09770) | - | 2050489..2050695 (+) | 207 | WP_024404519.1 | hypothetical protein | - |
| U0N78_RS09775 (U0N78_09775) | - | 2050707..2050907 (-) | 201 | WP_172073136.1 | hypothetical protein | - |
| U0N78_RS09780 (U0N78_09780) | - | 2051884..2052243 (+) | 360 | WP_172073137.1 | helix-turn-helix domain-containing protein | - |
| U0N78_RS09785 (U0N78_09785) | - | 2052253..2052474 (+) | 222 | WP_024399050.1 | DUF6290 family protein | - |
| U0N78_RS09790 (U0N78_09790) | - | 2052464..2052739 (+) | 276 | WP_024399051.1 | type II toxin-antitoxin system RelE family toxin | - |
| U0N78_RS09795 (U0N78_09795) | - | 2052802..2053350 (+) | 549 | WP_172120444.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15644.50 Da Isoelectric Point: 4.8836
>NTDB_id=912596 U0N78_RS09640 WP_174850415.1 2041055..2041471(-) (ssb) [Streptococcus suis strain 2022WUSS148]
MINNIVLVGRLTRDVELRYTPSNQAVATFTSAVNRNFKNQATGEREADFINCVIWNKQAENLANWTKKGHLIGITGRIQT
RSYDNQQGQRVYVTEVVAESFQLLEKRDNTANYSSMDEQMPPCISGQPMDIDDDGLPF
MINNIVLVGRLTRDVELRYTPSNQAVATFTSAVNRNFKNQATGEREADFINCVIWNKQAENLANWTKKGHLIGITGRIQT
RSYDNQQGQRVYVTEVVAESFQLLEKRDNTANYSSMDEQMPPCISGQPMDIDDDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=912596 U0N78_RS09640 WP_174850415.1 2041055..2041471(-) (ssb) [Streptococcus suis strain 2022WUSS148]
ATGATCAACAATATTGTTTTGGTTGGTAGATTGACGAGGGATGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACCTCGGCAGTTAACCGCAATTTTAAAAATCAAGCAACAGGAGAACGAGAAGCTGACTTTATCAATTGCGTTA
TTTGGAACAAGCAGGCTGAAAATTTAGCCAACTGGACCAAGAAAGGTCACTTGATTGGTATTACTGGACGAATCCAGACC
AGAAGCTACGATAACCAGCAAGGGCAACGTGTTTACGTTACTGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCCAGCATGGATGAGCAGATGCCACCATGCATCAGCGGCCAGCCGATGGATATTGATGATG
ACGGATTGCCGTTTTAG
ATGATCAACAATATTGTTTTGGTTGGTAGATTGACGAGGGATGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACCTCGGCAGTTAACCGCAATTTTAAAAATCAAGCAACAGGAGAACGAGAAGCTGACTTTATCAATTGCGTTA
TTTGGAACAAGCAGGCTGAAAATTTAGCCAACTGGACCAAGAAAGGTCACTTGATTGGTATTACTGGACGAATCCAGACC
AGAAGCTACGATAACCAGCAAGGGCAACGTGTTTACGTTACTGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCCAGCATGGATGAGCAGATGCCACCATGCATCAGCGGCCAGCCGATGGATATTGATGATG
ACGGATTGCCGTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.216 |
100 |
0.659 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.568 |
100 |
0.645 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.553 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.553 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.844 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.14 |
77.536 |
0.428 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
51.351 |
80.435 |
0.413 |
| ssb | Vibrio cholerae strain A1552 |
29.48 |
100 |
0.37 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
45.455 |
79.71 |
0.362 |
| ssbA | Streptococcus mutans UA159 |
45.045 |
80.435 |
0.362 |