Detailed information NTG0884966

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: RMQ61_RS00840
• Genome accession: NZ_CP135090
• Coordinates: 136495..136776 (+)
• Length: 93 a.a.
• NCBI ID: WP_313920909.1
• Uniprot ID: -
• Organism: Streptococcus suis strain ID48908
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 131495..141776

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMQ61_RS00815 (RMQ61_00815)	-	132351..132719 (+)	369	WP_313920907.1	DUF1033 family protein	-
RMQ61_RS00820 (RMQ61_00820)	tnpA	132855..133329 (-)	475	Protein_127	IS200/IS605 family transposase	-
RMQ61_RS00825 (RMQ61_00825)	-	133558..134508 (-)	951	WP_313920908.1	LD-carboxypeptidase	-
RMQ61_RS00830 (RMQ61_00830)	comYA	134594..135544 (+)	951	WP_105140681.1	competence type IV pilus ATPase ComGA	Machinery gene
RMQ61_RS00835 (RMQ61_00835)	comYB	135456..136493 (+)	1038	WP_313921433.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMQ61_RS00840 (RMQ61_00840)	comYC	136495..136776 (+)	282	WP_313920909.1	competence type IV pilus major pilin ComGC	Machinery gene
RMQ61_RS00845 (RMQ61_00845)	comGD	136757..137164 (+)	408	WP_313920910.1	competence type IV pilus minor pilin ComGD	-
RMQ61_RS00850 (RMQ61_00850)	comYE	137136..137429 (+)	294	WP_024413203.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMQ61_RS00855 (RMQ61_00855)	comGF/cglF	137416..137850 (+)	435	WP_024395445.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMQ61_RS00860 (RMQ61_00860)	comGG	137828..138355 (+)	528	WP_313920911.1	competence type IV pilus minor pilin ComGG	-
RMQ61_RS00865 (RMQ61_00865)	comYH	138411..139364 (+)	954	WP_105105703.1	class I SAM-dependent methyltransferase	Machinery gene
RMQ61_RS00870 (RMQ61_00870)	-	139414..140601 (+)	1188	WP_313920912.1	acetate kinase	-
RMQ61_RS00875 (RMQ61_00875)	-	140677..141540 (-)	864	WP_313926416.1	IS982 family transposase	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10413.31 Da
• Isoelectric Point: 5.8850

>NTDB_id=884966 RMQ61_RS00840 WP_313920909.1 136495..136776(+) (comYC) [Streptococcus suis strain ID48908]
MKKLVEMKVRAFTLVEMLVVLGIISLLLLLFVPNLSKQKETIKESGGTAVVKVVESQMELYELEHDKEATVADLQSAGYI
TEKQAEEYAKAKK

Nucleotide

• Length: 282 bp

>NTDB_id=884966 RMQ61_RS00840 WP_313920909.1 136495..136776(+) (comYC) [Streptococcus suis strain ID48908]
ATGAAAAAATTAGTTGAAATGAAGGTAAGAGCGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCCTTTTTGTGCCAAATTTGAGTAAGCAAAAAGAAACAATTAAGGAGTCCGGTGGTACGGCCGTAGTTAAGGTTG
TAGAAAGTCAGATGGAGCTCTATGAATTGGAGCATGATAAGGAAGCCACGGTGGCAGACTTGCAGTCGGCTGGCTATATT
ACTGAGAAACAAGCAGAAGAGTATGCTAAGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	82.796	100	0.828
comYC	Streptococcus mutans UA159	63.636	94.624	0.602
comYC	Streptococcus mutans UA140	63.636	94.624	0.602
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comGC/cglC	Streptococcus mitis SK321	63.529	91.398	0.581
comGC/cglC	Streptococcus mitis NCTC 12261	63.529	91.398	0.581
comGC/cglC	Streptococcus pneumoniae TIGR4	65.432	87.097	0.57
comGC/cglC	Streptococcus pneumoniae D39	65.432	87.097	0.57
comGC/cglC	Streptococcus pneumoniae R6	65.432	87.097	0.57
comGC/cglC	Streptococcus pneumoniae Rx1	65.432	87.097	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	80.645	0.376