Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RLO20_RS03630 | Genome accession | NZ_CP134538 |
| Coordinates | 756447..756839 (+) | Length | 130 a.a. |
| NCBI ID | WP_012679302.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. equi strain XJ5012 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 736411..791201 | 756447..756839 | within | 0 |
Gene organization within MGE regions
Location: 736411..791201
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RLO20_RS03535 (RLO20_03535) | - | 738609..739199 (+) | 591 | WP_042356873.1 | ABC transporter ATP-binding protein | - |
| RLO20_RS03540 (RLO20_03540) | - | 739209..740771 (+) | 1563 | WP_042356875.1 | ABC transporter ATP-binding protein | - |
| RLO20_RS03545 (RLO20_03545) | prfB | 741154..742255 (+) | 1102 | WP_111692358.1 | peptide chain release factor 2 | - |
| RLO20_RS03550 (RLO20_03550) | ftsE | 742306..742998 (+) | 693 | WP_012678167.1 | cell division ATP-binding protein FtsE | - |
| RLO20_RS03555 (RLO20_03555) | ftsX | 742991..743920 (+) | 930 | WP_042357406.1 | permease-like cell division protein FtsX | - |
| RLO20_RS03560 (RLO20_03560) | - | 744310..744951 (-) | 642 | WP_012679287.1 | MBL fold metallo-hydrolase | - |
| RLO20_RS03565 (RLO20_03565) | - | 745288..747759 (+) | 2472 | WP_317608683.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| RLO20_RS03570 (RLO20_03570) | - | 747933..749099 (-) | 1167 | WP_012679289.1 | site-specific integrase | - |
| RLO20_RS10680 | - | 749277..749534 (-) | 258 | WP_394854669.1 | hypothetical protein | - |
| RLO20_RS10685 | - | 749577..749831 (-) | 255 | Protein_679 | HIRAN domain-containing protein | - |
| RLO20_RS03580 (RLO20_03580) | - | 749859..750263 (-) | 405 | WP_012679291.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RLO20_RS03585 (RLO20_03585) | - | 750277..750627 (-) | 351 | WP_012679292.1 | helix-turn-helix domain-containing protein | - |
| RLO20_RS03595 (RLO20_03595) | - | 752486..752698 (+) | 213 | WP_012679293.1 | hypothetical protein | - |
| RLO20_RS03600 (RLO20_03600) | - | 752771..753022 (+) | 252 | WP_317608684.1 | hypothetical protein | - |
| RLO20_RS03605 (RLO20_03605) | - | 753298..753639 (+) | 342 | WP_012679297.1 | hypothetical protein | - |
| RLO20_RS03610 (RLO20_03610) | - | 753639..754121 (+) | 483 | WP_012679298.1 | siphovirus Gp157 family protein | - |
| RLO20_RS03615 (RLO20_03615) | - | 754118..754591 (+) | 474 | WP_012679299.1 | hypothetical protein | - |
| RLO20_RS03620 (RLO20_03620) | - | 754551..755726 (+) | 1176 | WP_050315853.1 | DEAD/DEAH box helicase family protein | - |
| RLO20_RS03625 (RLO20_03625) | - | 755736..756446 (+) | 711 | WP_012679301.1 | ERF family protein | - |
| RLO20_RS03630 (RLO20_03630) | ssbA | 756447..756839 (+) | 393 | WP_012679302.1 | single-stranded DNA-binding protein | Machinery gene |
| RLO20_RS03635 (RLO20_03635) | - | 756853..757680 (+) | 828 | WP_012679303.1 | bifunctional DNA primase/polymerase | - |
| RLO20_RS03640 (RLO20_03640) | - | 757664..759064 (+) | 1401 | WP_012679304.1 | virulence-associated E family protein | - |
| RLO20_RS03645 (RLO20_03645) | - | 759410..759604 (+) | 195 | WP_012679305.1 | hypothetical protein | - |
| RLO20_RS03650 (RLO20_03650) | - | 759597..759824 (+) | 228 | WP_012679306.1 | hypothetical protein | - |
| RLO20_RS03655 (RLO20_03655) | - | 759835..760524 (+) | 690 | WP_042356880.1 | site-specific DNA-methyltransferase | - |
| RLO20_RS03660 (RLO20_03660) | dcm | 760526..761317 (+) | 792 | WP_317608685.1 | DNA (cytosine-5-)-methyltransferase | - |
| RLO20_RS03665 (RLO20_03665) | - | 761301..761804 (+) | 504 | WP_050315851.1 | DNA cytosine methyltransferase | - |
| RLO20_RS03670 (RLO20_03670) | - | 761794..762312 (+) | 519 | WP_012679308.1 | DUF1642 domain-containing protein | - |
| RLO20_RS03675 (RLO20_03675) | - | 762339..762638 (+) | 300 | WP_042357412.1 | hypothetical protein | - |
| RLO20_RS03680 (RLO20_03680) | - | 762655..762828 (+) | 174 | WP_012679310.1 | hypothetical protein | - |
| RLO20_RS03685 (RLO20_03685) | - | 763165..763605 (+) | 441 | WP_012679312.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| RLO20_RS03690 (RLO20_03690) | - | 764003..764380 (-) | 378 | WP_012679314.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RLO20_RS03695 (RLO20_03695) | - | 764432..764617 (-) | 186 | WP_012679315.1 | type II toxin-antitoxin system HicA family toxin | - |
| RLO20_RS03700 (RLO20_03700) | - | 764733..765068 (+) | 336 | WP_012679316.1 | HNH endonuclease | - |
| RLO20_RS03705 (RLO20_03705) | - | 765231..765698 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| RLO20_RS03710 (RLO20_03710) | - | 765713..767467 (+) | 1755 | WP_012679317.1 | terminase large subunit | - |
| RLO20_RS03715 (RLO20_03715) | - | 767464..767634 (+) | 171 | WP_012679318.1 | hypothetical protein | - |
| RLO20_RS03720 (RLO20_03720) | - | 767627..767893 (+) | 267 | WP_012679319.1 | hypothetical protein | - |
| RLO20_RS03725 (RLO20_03725) | - | 767927..769147 (+) | 1221 | WP_012679320.1 | phage portal protein | - |
| RLO20_RS03730 (RLO20_03730) | - | 769125..769790 (+) | 666 | WP_012679321.1 | head maturation protease, ClpP-related | - |
| RLO20_RS03735 (RLO20_03735) | - | 769815..771002 (+) | 1188 | WP_012679322.1 | phage major capsid protein | - |
| RLO20_RS03740 (RLO20_03740) | - | 771016..771144 (+) | 129 | WP_012679323.1 | hypothetical protein | - |
| RLO20_RS03745 (RLO20_03745) | - | 771147..771449 (+) | 303 | WP_012679324.1 | head-tail connector protein | - |
| RLO20_RS03750 (RLO20_03750) | - | 771446..771793 (+) | 348 | WP_012679325.1 | phage head closure protein | - |
| RLO20_RS03755 (RLO20_03755) | - | 771790..772167 (+) | 378 | WP_012679326.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RLO20_RS03760 (RLO20_03760) | - | 772164..772589 (+) | 426 | WP_012679327.1 | hypothetical protein | - |
| RLO20_RS03765 (RLO20_03765) | - | 772605..773195 (+) | 591 | WP_012679328.1 | major tail protein | - |
| RLO20_RS03770 (RLO20_03770) | gpG | 773247..773573 (+) | 327 | WP_012679329.1 | phage tail assembly chaperone G | - |
| RLO20_RS03775 (RLO20_03775) | - | 773621..773770 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| RLO20_RS03780 (RLO20_03780) | - | 773783..777442 (+) | 3660 | WP_050316323.1 | phage tail tape measure protein | - |
| RLO20_RS03785 (RLO20_03785) | - | 777442..778149 (+) | 708 | WP_012679331.1 | distal tail protein Dit | - |
| RLO20_RS03790 (RLO20_03790) | - | 778146..780287 (+) | 2142 | WP_012679332.1 | phage tail spike protein | - |
| RLO20_RS03795 (RLO20_03795) | - | 780287..781048 (+) | 762 | WP_012679333.1 | collagen-like protein | - |
| RLO20_RS03800 (RLO20_03800) | - | 781050..781667 (+) | 618 | WP_012679334.1 | hypothetical protein | - |
| RLO20_RS03805 (RLO20_03805) | - | 781678..783561 (+) | 1884 | WP_012679335.1 | gp58-like family protein | - |
| RLO20_RS03810 (RLO20_03810) | - | 783570..784001 (+) | 432 | WP_214495195.1 | DUF1617 family protein | - |
| RLO20_RS03815 (RLO20_03815) | - | 784004..784618 (+) | 615 | WP_012679337.1 | DUF1366 domain-containing protein | - |
| RLO20_RS03820 (RLO20_03820) | - | 784631..784921 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| RLO20_RS03825 (RLO20_03825) | - | 784924..785103 (+) | 180 | WP_012679339.1 | holin | - |
| RLO20_RS03830 (RLO20_03830) | - | 785215..786411 (+) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| RLO20_RS03835 (RLO20_03835) | - | 786546..787088 (+) | 543 | WP_012679342.1 | Panacea domain-containing protein | - |
| RLO20_RS03840 (RLO20_03840) | - | 787092..787928 (+) | 837 | WP_012679343.1 | hypothetical protein | - |
| RLO20_RS03845 (RLO20_03845) | - | 788300..788875 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| RLO20_RS03855 (RLO20_03855) | prx | 789224..789406 (+) | 183 | WP_012679346.1 | hypothetical protein | Regulator |
| RLO20_RS03860 (RLO20_03860) | - | 789604..789993 (+) | 390 | WP_012515365.1 | DUF5590 domain-containing protein | - |
| RLO20_RS03865 (RLO20_03865) | - | 789990..791201 (+) | 1212 | WP_012679347.1 | pyridoxal phosphate-dependent aminotransferase | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14989.81 Da Isoelectric Point: 4.8660
>NTDB_id=880847 RLO20_RS03630 WP_012679302.1 756447..756839(+) (ssbA) [Streptococcus equi subsp. equi strain XJ5012]
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRAFKSQNGEREADFINCVIWRQQAENLANWAKKGVLIGITGRIQTR
NYENQQGQRVYVTEVVADNFKMLEYRQQQQQEDSFDNNNPMDIQADDLPF
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRAFKSQNGEREADFINCVIWRQQAENLANWAKKGVLIGITGRIQTR
NYENQQGQRVYVTEVVADNFKMLEYRQQQQQEDSFDNNNPMDIQADDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=880847 RLO20_RS03630 WP_012679302.1 756447..756839(+) (ssbA) [Streptococcus equi subsp. equi strain XJ5012]
ATGATTAATAATGTAGTACTAGTTGGTCGTATGACCAAGGACGCAGAGCTTCGATACACTCCAAGTCAGGTGGCAGTTGC
TACGTTTACACTTGCTGTTAATCGCGCCTTTAAGAGCCAAAATGGTGAGCGCGAAGCGGATTTCATTAACTGTGTGATCT
GGCGTCAGCAAGCTGAAAATTTAGCTAACTGGGCGAAAAAGGGTGTCTTGATTGGGATTACAGGACGTATTCAGACCCGT
AACTACGAAAACCAACAGGGGCAGCGTGTGTATGTAACCGAGGTTGTTGCAGATAATTTCAAAATGCTGGAATACCGCCA
GCAACAGCAGCAAGAGGATTCATTCGATAATAACAATCCAATGGATATTCAGGCTGACGACTTGCCATTCTAA
ATGATTAATAATGTAGTACTAGTTGGTCGTATGACCAAGGACGCAGAGCTTCGATACACTCCAAGTCAGGTGGCAGTTGC
TACGTTTACACTTGCTGTTAATCGCGCCTTTAAGAGCCAAAATGGTGAGCGCGAAGCGGATTTCATTAACTGTGTGATCT
GGCGTCAGCAAGCTGAAAATTTAGCTAACTGGGCGAAAAAGGGTGTCTTGATTGGGATTACAGGACGTATTCAGACCCGT
AACTACGAAAACCAACAGGGGCAGCGTGTGTATGTAACCGAGGTTGTTGCAGATAATTTCAAAATGCTGGAATACCGCCA
GCAACAGCAGCAAGAGGATTCATTCGATAATAACAATCCAATGGATATTCAGGCTGACGACTTGCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.163 |
100 |
0.677 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
69.369 |
85.385 |
0.592 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.185 |
100 |
0.469 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.982 |
86.923 |
0.469 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.697 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.939 |
100 |
0.446 |
| ssbA | Streptococcus mutans UA159 |
41.667 |
100 |
0.423 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
40.31 |
99.231 |
0.4 |