Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   RLO20_RS03855 Genome accession   NZ_CP134538
Coordinates   789224..789406 (+) Length   60 a.a.
NCBI ID   WP_012679346.1    Uniprot ID   C0MBQ2
Organism   Streptococcus equi subsp. equi strain XJ5012     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 736411..791201 789224..789406 within 0


Gene organization within MGE regions


Location: 736411..791201
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RLO20_RS03535 (RLO20_03535) - 738609..739199 (+) 591 WP_042356873.1 ABC transporter ATP-binding protein -
  RLO20_RS03540 (RLO20_03540) - 739209..740771 (+) 1563 WP_042356875.1 ABC transporter ATP-binding protein -
  RLO20_RS03545 (RLO20_03545) prfB 741154..742255 (+) 1102 WP_111692358.1 peptide chain release factor 2 -
  RLO20_RS03550 (RLO20_03550) ftsE 742306..742998 (+) 693 WP_012678167.1 cell division ATP-binding protein FtsE -
  RLO20_RS03555 (RLO20_03555) ftsX 742991..743920 (+) 930 WP_042357406.1 permease-like cell division protein FtsX -
  RLO20_RS03560 (RLO20_03560) - 744310..744951 (-) 642 WP_012679287.1 MBL fold metallo-hydrolase -
  RLO20_RS03565 (RLO20_03565) - 745288..747759 (+) 2472 WP_317608683.1 bifunctional DnaQ family exonuclease/ATP-dependent helicase -
  RLO20_RS03570 (RLO20_03570) - 747933..749099 (-) 1167 WP_012679289.1 site-specific integrase -
  RLO20_RS10680 - 749277..749534 (-) 258 WP_394854669.1 hypothetical protein -
  RLO20_RS10685 - 749577..749831 (-) 255 Protein_679 HIRAN domain-containing protein -
  RLO20_RS03580 (RLO20_03580) - 749859..750263 (-) 405 WP_012679291.1 ImmA/IrrE family metallo-endopeptidase -
  RLO20_RS03585 (RLO20_03585) - 750277..750627 (-) 351 WP_012679292.1 helix-turn-helix domain-containing protein -
  RLO20_RS03595 (RLO20_03595) - 752486..752698 (+) 213 WP_012679293.1 hypothetical protein -
  RLO20_RS03600 (RLO20_03600) - 752771..753022 (+) 252 WP_317608684.1 hypothetical protein -
  RLO20_RS03605 (RLO20_03605) - 753298..753639 (+) 342 WP_012679297.1 hypothetical protein -
  RLO20_RS03610 (RLO20_03610) - 753639..754121 (+) 483 WP_012679298.1 siphovirus Gp157 family protein -
  RLO20_RS03615 (RLO20_03615) - 754118..754591 (+) 474 WP_012679299.1 hypothetical protein -
  RLO20_RS03620 (RLO20_03620) - 754551..755726 (+) 1176 WP_050315853.1 DEAD/DEAH box helicase family protein -
  RLO20_RS03625 (RLO20_03625) - 755736..756446 (+) 711 WP_012679301.1 ERF family protein -
  RLO20_RS03630 (RLO20_03630) ssbA 756447..756839 (+) 393 WP_012679302.1 single-stranded DNA-binding protein Machinery gene
  RLO20_RS03635 (RLO20_03635) - 756853..757680 (+) 828 WP_012679303.1 bifunctional DNA primase/polymerase -
  RLO20_RS03640 (RLO20_03640) - 757664..759064 (+) 1401 WP_012679304.1 virulence-associated E family protein -
  RLO20_RS03645 (RLO20_03645) - 759410..759604 (+) 195 WP_012679305.1 hypothetical protein -
  RLO20_RS03650 (RLO20_03650) - 759597..759824 (+) 228 WP_012679306.1 hypothetical protein -
  RLO20_RS03655 (RLO20_03655) - 759835..760524 (+) 690 WP_042356880.1 site-specific DNA-methyltransferase -
  RLO20_RS03660 (RLO20_03660) dcm 760526..761317 (+) 792 WP_317608685.1 DNA (cytosine-5-)-methyltransferase -
  RLO20_RS03665 (RLO20_03665) - 761301..761804 (+) 504 WP_050315851.1 DNA cytosine methyltransferase -
  RLO20_RS03670 (RLO20_03670) - 761794..762312 (+) 519 WP_012679308.1 DUF1642 domain-containing protein -
  RLO20_RS03675 (RLO20_03675) - 762339..762638 (+) 300 WP_042357412.1 hypothetical protein -
  RLO20_RS03680 (RLO20_03680) - 762655..762828 (+) 174 WP_012679310.1 hypothetical protein -
  RLO20_RS03685 (RLO20_03685) - 763165..763605 (+) 441 WP_012679312.1 ArpU family phage packaging/lysis transcriptional regulator -
  RLO20_RS03690 (RLO20_03690) - 764003..764380 (-) 378 WP_012679314.1 type II toxin-antitoxin system HicB family antitoxin -
  RLO20_RS03695 (RLO20_03695) - 764432..764617 (-) 186 WP_012679315.1 type II toxin-antitoxin system HicA family toxin -
  RLO20_RS03700 (RLO20_03700) - 764733..765068 (+) 336 WP_012679316.1 HNH endonuclease -
  RLO20_RS03705 (RLO20_03705) - 765231..765698 (+) 468 WP_002985371.1 phage terminase small subunit P27 family -
  RLO20_RS03710 (RLO20_03710) - 765713..767467 (+) 1755 WP_012679317.1 terminase large subunit -
  RLO20_RS03715 (RLO20_03715) - 767464..767634 (+) 171 WP_012679318.1 hypothetical protein -
  RLO20_RS03720 (RLO20_03720) - 767627..767893 (+) 267 WP_012679319.1 hypothetical protein -
  RLO20_RS03725 (RLO20_03725) - 767927..769147 (+) 1221 WP_012679320.1 phage portal protein -
  RLO20_RS03730 (RLO20_03730) - 769125..769790 (+) 666 WP_012679321.1 head maturation protease, ClpP-related -
  RLO20_RS03735 (RLO20_03735) - 769815..771002 (+) 1188 WP_012679322.1 phage major capsid protein -
  RLO20_RS03740 (RLO20_03740) - 771016..771144 (+) 129 WP_012679323.1 hypothetical protein -
  RLO20_RS03745 (RLO20_03745) - 771147..771449 (+) 303 WP_012679324.1 head-tail connector protein -
  RLO20_RS03750 (RLO20_03750) - 771446..771793 (+) 348 WP_012679325.1 phage head closure protein -
  RLO20_RS03755 (RLO20_03755) - 771790..772167 (+) 378 WP_012679326.1 HK97-gp10 family putative phage morphogenesis protein -
  RLO20_RS03760 (RLO20_03760) - 772164..772589 (+) 426 WP_012679327.1 hypothetical protein -
  RLO20_RS03765 (RLO20_03765) - 772605..773195 (+) 591 WP_012679328.1 major tail protein -
  RLO20_RS03770 (RLO20_03770) gpG 773247..773573 (+) 327 WP_012679329.1 phage tail assembly chaperone G -
  RLO20_RS03775 (RLO20_03775) - 773621..773770 (+) 150 WP_021299462.1 hypothetical protein -
  RLO20_RS03780 (RLO20_03780) - 773783..777442 (+) 3660 WP_050316323.1 phage tail tape measure protein -
  RLO20_RS03785 (RLO20_03785) - 777442..778149 (+) 708 WP_012679331.1 distal tail protein Dit -
  RLO20_RS03790 (RLO20_03790) - 778146..780287 (+) 2142 WP_012679332.1 phage tail spike protein -
  RLO20_RS03795 (RLO20_03795) - 780287..781048 (+) 762 WP_012679333.1 collagen-like protein -
  RLO20_RS03800 (RLO20_03800) - 781050..781667 (+) 618 WP_012679334.1 hypothetical protein -
  RLO20_RS03805 (RLO20_03805) - 781678..783561 (+) 1884 WP_012679335.1 gp58-like family protein -
  RLO20_RS03810 (RLO20_03810) - 783570..784001 (+) 432 WP_214495195.1 DUF1617 family protein -
  RLO20_RS03815 (RLO20_03815) - 784004..784618 (+) 615 WP_012679337.1 DUF1366 domain-containing protein -
  RLO20_RS03820 (RLO20_03820) - 784631..784921 (+) 291 WP_012679338.1 hypothetical protein -
  RLO20_RS03825 (RLO20_03825) - 784924..785103 (+) 180 WP_012679339.1 holin -
  RLO20_RS03830 (RLO20_03830) - 785215..786411 (+) 1197 WP_012679341.1 glucosaminidase domain-containing protein -
  RLO20_RS03835 (RLO20_03835) - 786546..787088 (+) 543 WP_012679342.1 Panacea domain-containing protein -
  RLO20_RS03840 (RLO20_03840) - 787092..787928 (+) 837 WP_012679343.1 hypothetical protein -
  RLO20_RS03845 (RLO20_03845) - 788300..788875 (+) 576 WP_012679345.1 phospholipase A2 SlaA -
  RLO20_RS03855 (RLO20_03855) prx 789224..789406 (+) 183 WP_012679346.1 hypothetical protein Regulator
  RLO20_RS03860 (RLO20_03860) - 789604..789993 (+) 390 WP_012515365.1 DUF5590 domain-containing protein -
  RLO20_RS03865 (RLO20_03865) - 789990..791201 (+) 1212 WP_012679347.1 pyridoxal phosphate-dependent aminotransferase -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6943.77 Da        Isoelectric Point: 4.1677

>NTDB_id=880848 RLO20_RS03855 WP_012679346.1 789224..789406(+) (prx) [Streptococcus equi subsp. equi strain XJ5012]
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVRNGEVVTDEKVEEVMRELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=880848 RLO20_RS03855 WP_012679346.1 789224..789406(+) (prx) [Streptococcus equi subsp. equi strain XJ5012]
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTAAGGAACGGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB C0MBQ2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

85

100

0.85

  prx Streptococcus pyogenes MGAS8232

80

100

0.8

  prx Streptococcus pyogenes MGAS315

78.333

100

0.783

  prx Streptococcus pyogenes MGAS315

76.667

100

0.767

  prx Streptococcus pyogenes MGAS315

76.667

100

0.767

  prx Streptococcus pyogenes MGAS315

86.047

71.667

0.617

  prx Streptococcus pyogenes MGAS315

73.81

70

0.517