Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RJW55_RS10185 | Genome accession | NZ_CP134473 |
| Coordinates | 2169848..2170264 (-) | Length | 138 a.a. |
| NCBI ID | WP_043024716.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain TMW_SS028 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2148746..2182143 | 2169848..2170264 | within | 0 |
Gene organization within MGE regions
Location: 2148746..2182143
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RJW55_RS10050 (RJW55_10050) | - | 2148746..2149150 (-) | 405 | WP_024399138.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RJW55_RS10055 (RJW55_10055) | - | 2149211..2149396 (-) | 186 | WP_029185622.1 | type II toxin-antitoxin system HicA family toxin | - |
| RJW55_RS10060 (RJW55_10060) | - | 2149579..2151000 (-) | 1422 | WP_043026720.1 | peptidoglycan amidohydrolase family protein | - |
| RJW55_RS10065 (RJW55_10065) | - | 2151088..2151333 (-) | 246 | WP_029172929.1 | phage holin | - |
| RJW55_RS10070 (RJW55_10070) | - | 2151337..2151762 (-) | 426 | WP_029172930.1 | hypothetical protein | - |
| RJW55_RS10075 (RJW55_10075) | - | 2151766..2152011 (-) | 246 | WP_029172931.1 | hypothetical protein | - |
| RJW55_RS10080 (RJW55_10080) | - | 2152014..2152226 (-) | 213 | WP_061631527.1 | hypothetical protein | - |
| RJW55_RS10085 (RJW55_10085) | - | 2152235..2155381 (-) | 3147 | WP_061756372.1 | phage tail spike protein | - |
| RJW55_RS10090 (RJW55_10090) | - | 2155382..2156104 (-) | 723 | WP_172045804.1 | phage tail protein | - |
| RJW55_RS10095 (RJW55_10095) | - | 2156101..2158905 (-) | 2805 | WP_172073076.1 | phage tail tape measure protein | - |
| RJW55_RS10100 (RJW55_10100) | - | 2159094..2159567 (-) | 474 | WP_043024729.1 | hypothetical protein | - |
| RJW55_RS10105 (RJW55_10105) | - | 2159567..2160259 (-) | 693 | WP_043024728.1 | phage tail protein | - |
| RJW55_RS10110 (RJW55_10110) | - | 2160274..2160618 (-) | 345 | WP_043024727.1 | hypothetical protein | - |
| RJW55_RS10115 (RJW55_10115) | - | 2160605..2160952 (-) | 348 | WP_043024726.1 | hypothetical protein | - |
| RJW55_RS10120 (RJW55_10120) | - | 2160952..2161257 (-) | 306 | WP_043024725.1 | phage head closure protein | - |
| RJW55_RS10125 (RJW55_10125) | - | 2161254..2161589 (-) | 336 | WP_043024724.1 | hypothetical protein | - |
| RJW55_RS10130 (RJW55_10130) | - | 2161611..2162873 (-) | 1263 | WP_172073075.1 | phage major capsid protein | - |
| RJW55_RS10135 (RJW55_10135) | - | 2162886..2163428 (-) | 543 | WP_024398435.1 | HK97 family phage prohead protease | - |
| RJW55_RS10140 (RJW55_10140) | - | 2163479..2164621 (-) | 1143 | WP_079395270.1 | phage portal protein | - |
| RJW55_RS10145 (RJW55_10145) | - | 2164630..2166267 (-) | 1638 | WP_231640485.1 | terminase TerL endonuclease subunit | - |
| RJW55_RS10150 (RJW55_10150) | - | 2166335..2166820 (-) | 486 | WP_052496988.1 | hypothetical protein | - |
| RJW55_RS10155 (RJW55_10155) | - | 2166908..2167270 (-) | 363 | WP_043024722.1 | HNH endonuclease signature motif containing protein | - |
| RJW55_RS10160 (RJW55_10160) | - | 2167695..2168237 (-) | 543 | WP_043024721.1 | site-specific integrase | - |
| RJW55_RS10165 (RJW55_10165) | - | 2168349..2168813 (-) | 465 | WP_043024720.1 | hypothetical protein | - |
| RJW55_RS10170 (RJW55_10170) | - | 2168779..2169024 (-) | 246 | WP_024398442.1 | hypothetical protein | - |
| RJW55_RS10175 (RJW55_10175) | - | 2168993..2169127 (-) | 135 | WP_269434359.1 | hypothetical protein | - |
| RJW55_RS10180 (RJW55_10180) | - | 2169318..2169584 (-) | 267 | WP_043024718.1 | hypothetical protein | - |
| RJW55_RS10185 (RJW55_10185) | ssb | 2169848..2170264 (-) | 417 | WP_043024716.1 | single-stranded DNA-binding protein | Machinery gene |
| RJW55_RS10190 (RJW55_10190) | - | 2170268..2170531 (-) | 264 | WP_043024715.1 | helix-turn-helix transcriptional regulator | - |
| RJW55_RS10195 (RJW55_10195) | - | 2170540..2170998 (-) | 459 | WP_043024714.1 | class I SAM-dependent methyltransferase | - |
| RJW55_RS10200 (RJW55_10200) | - | 2171126..2171347 (-) | 222 | WP_043024713.1 | hypothetical protein | - |
| RJW55_RS10205 (RJW55_10205) | - | 2171340..2171693 (-) | 354 | WP_043027196.1 | YopX family protein | - |
| RJW55_RS10210 (RJW55_10210) | - | 2171677..2171856 (-) | 180 | WP_043027195.1 | hypothetical protein | - |
| RJW55_RS10215 (RJW55_10215) | - | 2171856..2172428 (-) | 573 | WP_061844414.1 | DUF1642 domain-containing protein | - |
| RJW55_RS10220 (RJW55_10220) | - | 2172421..2172777 (-) | 357 | WP_043027197.1 | hypothetical protein | - |
| RJW55_RS10225 (RJW55_10225) | - | 2172782..2173099 (-) | 318 | WP_043025578.1 | hypothetical protein | - |
| RJW55_RS10230 (RJW55_10230) | - | 2173110..2173784 (-) | 675 | WP_043025580.1 | DNA methyltransferase | - |
| RJW55_RS10235 (RJW55_10235) | - | 2173837..2173902 (-) | 66 | Protein_1988 | DNA cytosine methyltransferase | - |
| RJW55_RS10240 (RJW55_10240) | - | 2174023..2174196 (-) | 174 | WP_162841075.1 | hypothetical protein | - |
| RJW55_RS10245 (RJW55_10245) | - | 2174183..2174620 (-) | 438 | WP_043025581.1 | hypothetical protein | - |
| RJW55_RS10250 (RJW55_10250) | - | 2174684..2174851 (-) | 168 | WP_153308617.1 | hypothetical protein | - |
| RJW55_RS10255 (RJW55_10255) | - | 2174851..2175069 (-) | 219 | WP_043025582.1 | hypothetical protein | - |
| RJW55_RS10260 (RJW55_10260) | - | 2175057..2175857 (-) | 801 | WP_024376892.1 | phage replisome organizer N-terminal domain-containing protein | - |
| RJW55_RS10265 (RJW55_10265) | - | 2175841..2176005 (-) | 165 | WP_197315058.1 | hypothetical protein | - |
| RJW55_RS10270 (RJW55_10270) | - | 2176020..2176274 (-) | 255 | WP_172045802.1 | hypothetical protein | - |
| RJW55_RS10275 (RJW55_10275) | - | 2176276..2176464 (-) | 189 | WP_172045801.1 | hypothetical protein | - |
| RJW55_RS10280 (RJW55_10280) | - | 2176461..2176745 (-) | 285 | WP_043025587.1 | hypothetical protein | - |
| RJW55_RS10285 (RJW55_10285) | - | 2176806..2177270 (-) | 465 | WP_043025589.1 | hypothetical protein | - |
| RJW55_RS10290 (RJW55_10290) | - | 2177334..2178041 (-) | 708 | WP_172073135.1 | ORF6C domain-containing protein | - |
| RJW55_RS10295 (RJW55_10295) | - | 2178095..2178526 (+) | 432 | WP_029178370.1 | hypothetical protein | - |
| RJW55_RS10300 (RJW55_10300) | - | 2178679..2178813 (-) | 135 | WP_256769127.1 | hypothetical protein | - |
| RJW55_RS10305 (RJW55_10305) | - | 2178806..2179003 (-) | 198 | WP_024405319.1 | hypothetical protein | - |
| RJW55_RS10310 (RJW55_10310) | - | 2179008..2179220 (-) | 213 | WP_043025601.1 | transcriptional regulator | - |
| RJW55_RS10315 (RJW55_10315) | - | 2179282..2179488 (+) | 207 | WP_024404519.1 | hypothetical protein | - |
| RJW55_RS10320 (RJW55_10320) | - | 2179500..2179700 (-) | 201 | WP_172073136.1 | hypothetical protein | - |
| RJW55_RS10325 (RJW55_10325) | - | 2180677..2181036 (+) | 360 | WP_172073137.1 | helix-turn-helix domain-containing protein | - |
| RJW55_RS10330 (RJW55_10330) | - | 2181046..2181267 (+) | 222 | WP_024399050.1 | DUF6290 family protein | - |
| RJW55_RS10335 (RJW55_10335) | - | 2181257..2181532 (+) | 276 | WP_024399051.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| RJW55_RS10340 (RJW55_10340) | - | 2181562..2182143 (+) | 582 | WP_256769128.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15670.58 Da Isoelectric Point: 4.8836
>NTDB_id=880183 RJW55_RS10185 WP_043024716.1 2169848..2170264(-) (ssb) [Streptococcus suis strain TMW_SS028]
MINNIVLVGRLTRDVELRYTPSNQAVATFTLAVNRNFKNQATGEREADFINCVIWNKQAENLANWTKKGHLIGITGRIQT
RSYDNQQGQRVYVTEVVAESFQLLEKRDNTANYSSMDEQMPPCISGQPMDIDDDGLPF
MINNIVLVGRLTRDVELRYTPSNQAVATFTLAVNRNFKNQATGEREADFINCVIWNKQAENLANWTKKGHLIGITGRIQT
RSYDNQQGQRVYVTEVVAESFQLLEKRDNTANYSSMDEQMPPCISGQPMDIDDDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=880183 RJW55_RS10185 WP_043024716.1 2169848..2170264(-) (ssb) [Streptococcus suis strain TMW_SS028]
ATGATCAACAATATTGTTTTGGTTGGTAGATTGACGAGGGATGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACCTTGGCAGTTAACCGCAATTTTAAAAATCAAGCAACAGGAGAACGAGAAGCTGACTTTATCAATTGCGTTA
TTTGGAACAAGCAGGCTGAAAATTTAGCCAACTGGACCAAGAAAGGTCACTTGATTGGTATTACTGGACGAATCCAGACC
AGAAGCTACGATAACCAGCAAGGGCAACGTGTTTACGTTACTGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCCAGCATGGATGAGCAGATGCCACCATGCATCAGCGGCCAGCCGATGGATATTGATGATG
ACGGATTGCCGTTTTAG
ATGATCAACAATATTGTTTTGGTTGGTAGATTGACGAGGGATGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACCTTGGCAGTTAACCGCAATTTTAAAAATCAAGCAACAGGAGAACGAGAAGCTGACTTTATCAATTGCGTTA
TTTGGAACAAGCAGGCTGAAAATTTAGCCAACTGGACCAAGAAAGGTCACTTGATTGGTATTACTGGACGAATCCAGACC
AGAAGCTACGATAACCAGCAAGGGCAACGTGTTTACGTTACTGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCCAGCATGGATGAGCAGATGCCACCATGCATCAGCGGCCAGCCGATGGATATTGATGATG
ACGGATTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.216 |
100 |
0.659 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.136 |
100 |
0.652 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.075 |
77.536 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.553 |
100 |
0.435 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.553 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.844 |
100 |
0.428 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
52.252 |
80.435 |
0.42 |
| ssb | Vibrio cholerae strain A1552 |
29.48 |
100 |
0.37 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
46.364 |
79.71 |
0.37 |
| ssbA | Streptococcus mutans UA159 |
45.946 |
80.435 |
0.37 |