NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	RDV59_RS00305	Genome accession	NZ_CP133476
Coordinates	50209..50523 (-)	Length	104 a.a.
NCBI ID	WP_170314557.1	Uniprot ID	-
Organism	Streptococcus salivarius strain LMG 11489
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 45209..55523

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RDV59_RS00265 (RDV59_00265)	-	45473..46129 (-)	657	WP_002887011.1	CPBP family intramembrane glutamic endopeptidase	-
RDV59_RS00270 (RDV59_00270)	-	46141..46338 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
RDV59_RS00275 (RDV59_00275)	-	46589..47782 (-)	1194	WP_002885831.1	acetate kinase	-
RDV59_RS00280 (RDV59_00280)	comYH	47839..48795 (-)	957	WP_038676858.1	class I SAM-dependent methyltransferase	Machinery gene
RDV59_RS00285 (RDV59_00285)	comGG	48840..49157 (-)	318	WP_002887013.1	competence type IV pilus minor pilin ComGG	-
RDV59_RS00290 (RDV59_00290)	comYF	49135..49572 (-)	438	WP_002887014.1	competence type IV pilus minor pilin ComGF	Machinery gene
RDV59_RS00295 (RDV59_00295)	comGE	49559..49789 (-)	231	WP_002887015.1	competence type IV pilus minor pilin ComGE	-
RDV59_RS00300 (RDV59_00300)	comYD	49821..50249 (-)	429	WP_254593949.1	competence type IV pilus minor pilin ComGD	Machinery gene
RDV59_RS00305 (RDV59_00305)	comYC	50209..50523 (-)	315	WP_170314557.1	competence type IV pilus major pilin ComGC	Machinery gene
RDV59_RS00310 (RDV59_00310)	comYB	50532..51632 (-)	1101	WP_126405090.1	competence type IV pilus assembly protein ComGB	Machinery gene
RDV59_RS00315 (RDV59_00315)	comGA/cglA/cilD	51514..52455 (-)	942	WP_038676863.1	competence type IV pilus ATPase ComGA	Machinery gene
RDV59_RS00320 (RDV59_00320)	-	52535..52897 (-)	363	WP_002887019.1	DUF1033 family protein	-

Sequence

Protein

Download Length: 104 a.a. Molecular weight: 11442.38 Da Isoelectric Point: 9.9219

                                >NTDB_id=874633 RDV59_RS00305 WP_170314557.1 50209..50523(-) (comYC) [Streptococcus salivarius strain LMG 11489]

MKKLKAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVSEGQI

TQKQADSYNDYYAKHGGESRSVAN

Nucleotide

Download Length: 315 bp

                                >NTDB_id=874633 RDV59_RS00305 WP_170314557.1 50209..50523(-) (comYC) [Streptococcus salivarius strain LMG 11489]

TTGAAAAAATTGAAGGCCGTTAAATTACGTGCTTTTACGCTGATTGAAATGCTGGTCGTGCTTCTCATTATCAGTATTCT

CCTTTTGCTCTTTGTACCTAACTTGAGCAAGCAGAAGGATTCTGTTAAAGAGACTGGAAATGCGGCTGTGGTCAAGGTCG

TGGATTCTCAAGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTAGCCGCTCTTGTTTCAGAAGGTCAAATC

ACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGCGAAAGCCGTTCAGTGGCCAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	71.154	100	0.712
comYC	Streptococcus mutans UA159	71.154	100	0.712
comYC	Streptococcus gordonii str. Challis substr. CH1	65.714	100	0.663
comGC/cglC	Streptococcus mitis SK321	64.646	95.192	0.615
comGC/cglC	Streptococcus pneumoniae TIGR4	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae D39	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae Rx1	59.804	98.077	0.587
comGC/cglC	Streptococcus pneumoniae R6	59.804	98.077	0.587
comGC/cglC	Streptococcus mitis NCTC 12261	60.396	97.115	0.587
comGC	Lactococcus lactis subsp. cremoris KW2	58.416	97.115	0.567
comYC	Streptococcus suis isolate S10	61.364	84.615	0.519
comGC	Staphylococcus aureus MW2	50	75	0.375
comGC	Staphylococcus aureus N315	50	75	0.375

Detailed information NTG0874633