Detailed information NTG0852894

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QYE83_RS06025
• Genome accession: NZ_CP129372
• Coordinates: 1276989..1277306 (+)
• Length: 105 a.a.
• NCBI ID: WP_002446532.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain CCSH-141
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1271989..1282306

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QYE83_RS05995	-	1272766..1272966 (+)	201	WP_002446537.1	YqgQ family protein	-
QYE83_RS06000	-	1272966..1273952 (+)	987	WP_002446536.1	ROK family glucokinase	-
QYE83_RS06005	-	1273952..1274278 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
QYE83_RS06010	-	1274278..1274901 (+)	624	WP_150871737.1	MBL fold metallo-hydrolase	-
QYE83_RS06015	comGA	1274958..1275932 (+)	975	WP_002446534.1	competence type IV pilus ATPase ComGA	Machinery gene
QYE83_RS06020	comGB	1275904..1276971 (+)	1068	WP_002446533.1	competence type IV pilus assembly protein ComGB	Machinery gene
QYE83_RS06025	comGC	1276989..1277306 (+)	318	WP_002446532.1	competence type IV pilus major pilin ComGC	Machinery gene
QYE83_RS06030	comGD	1277296..1277733 (+)	438	WP_002446531.1	competence type IV pilus minor pilin ComGD	-
QYE83_RS06035	-	1277720..1278013 (+)	294	WP_002446530.1	hypothetical protein	-
QYE83_RS06040	comGF	1277937..1278428 (+)	492	WP_002446529.1	competence type IV pilus minor pilin ComGF	-
QYE83_RS06045	-	1278593..1279105 (+)	513	WP_002446528.1	shikimate kinase	-
QYE83_RS06050	gcvT	1279323..1280414 (+)	1092	WP_301555490.1	glycine cleavage system aminomethyltransferase GcvT	-
QYE83_RS06055	gcvPA	1280434..1281780 (+)	1347	WP_002446526.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.53 Da
• Isoelectric Point: 9.2160

>NTDB_id=852894 QYE83_RS06025 WP_002446532.1 1276989..1277306(+) (comGC) [Staphylococcus epidermidis strain CCSH-141]
MKTLKLLKQTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=852894 QYE83_RS06025 WP_002446532.1 1276989..1277306(+) (comGC) [Staphylococcus epidermidis strain CCSH-141]
ATGAAAACATTGAAATTATTGAAACAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATCAGTTT
ATTATTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAACCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comGC/cglC	Streptococcus mitis SK321	43.689	98.095	0.429
comGC/cglC	Streptococcus pneumoniae R6	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae D39	43.617	89.524	0.39
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	50	72.381	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	78.095	0.362