Detailed information NTG0851365

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLUC029_RS11940
• Genome accession: NZ_CP129163
• Coordinates: 2275353..2275703 (-)
• Length: 116 a.a.
• NCBI ID: WP_050574187.1
• Uniprot ID: A0A1V0PEI8
• Organism: Lactococcus cremoris strain UC029
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2270353..2280703

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC029_RS11900 (LLUC029_11925)	-	2270889..2271698 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLUC029_RS11905 (LLUC029_11930)	-	2271691..2272428 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLUC029_RS11910 (LLUC029_11935)	-	2272607..2273449 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUC029_RS11915 (LLUC029_11940)	-	2273446..2273883 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LLUC029_RS11920 (LLUC029_11945)	comGG	2273963..2274190 (-)	228	WP_228764408.1	competence protein ComGG	Machinery gene
LLUC029_RS11925 (LLUC029_11950)	comGF	2274286..2274732 (-)	447	WP_011836043.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC029_RS11930 (LLUC029_11955)	comGE	2274695..2274931 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC029_RS11935 (LLUC029_11960)	comGD	2274963..2275151 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUC029_RS11940 (LLUC029_11965)	comGC	2275353..2275703 (-)	351	WP_050574187.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC029_RS11945 (LLUC029_11970)	comGB	2275748..2276773 (-)	1026	WP_050595614.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC029_RS11950 (LLUC029_11975)	comGA	2276673..2277653 (-)	981	WP_032951299.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 116 a.a.
• Molecular weight: 13315.52 Da
• Isoelectric Point: 7.2003

>NTDB_id=851365 LLUC029_RS11940 WP_050574187.1 2275353..2275703(-) (comGC) [Lactococcus cremoris strain UC029]
MIKALSLIKIHGRKLWQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD

Nucleotide

• Length: 351 bp

>NTDB_id=851365 LLUC029_RS11940 WP_050574187.1 2275353..2275703(-) (comGC) [Lactococcus cremoris strain UC029]
ATGATCAAAGCTTTGTCATTAATTAAAATTCACGGAAGAAAGCTTTGGCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (18-41)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	97.414	100	0.974
comYC	Streptococcus gordonii str. Challis substr. CH1	58.586	85.345	0.5
comGC/cglC	Streptococcus mitis SK321	55.882	87.931	0.491
comGC/cglC	Streptococcus pneumoniae R6	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae TIGR4	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae Rx1	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae D39	53.922	87.931	0.474
comYC	Streptococcus mutans UA140	59.14	80.172	0.474
comYC	Streptococcus mutans UA159	59.14	80.172	0.474
comGC/cglC	Streptococcus mitis NCTC 12261	55.67	83.621	0.466
comYC	Streptococcus suis isolate S10	56.818	75.862	0.431