Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLUC029_RS04315 | Genome accession | NZ_CP129163 |
| Coordinates | 835885..836310 (+) | Length | 141 a.a. |
| NCBI ID | WP_032950583.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC029 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 828921..847614 | 835885..836310 | within | 0 |
Gene organization within MGE regions
Location: 828921..847614
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC029_RS04255 (LLUC029_04260) | - | 828921..829811 (-) | 891 | WP_139949744.1 | IS982 family transposase | - |
| LLUC029_RS04260 (LLUC029_04265) | - | 829884..830774 (-) | 891 | WP_231099708.1 | site-specific integrase | - |
| LLUC029_RS04265 (LLUC029_04270) | - | 830824..831636 (-) | 813 | WP_050595598.1 | S24 family peptidase | - |
| LLUC029_RS04270 (LLUC029_04275) | - | 831899..832102 (+) | 204 | WP_021165564.1 | putative transcriptional regulator | - |
| LLUC029_RS04275 (LLUC029_04280) | - | 832443..832682 (+) | 240 | WP_023349341.1 | helix-turn-helix transcriptional regulator | - |
| LLUC029_RS04280 (LLUC029_04285) | - | 832696..833421 (+) | 726 | WP_021165562.1 | ORF6C domain-containing protein | - |
| LLUC029_RS04285 (LLUC029_04290) | - | 833434..833670 (+) | 237 | WP_011834775.1 | helix-turn-helix domain-containing protein | - |
| LLUC029_RS04290 (LLUC029_04295) | - | 833824..834057 (+) | 234 | WP_011834776.1 | hypothetical protein | - |
| LLUC029_RS04295 (LLUC029_04300) | - | 834012..834290 (-) | 279 | WP_396425096.1 | hypothetical protein | - |
| LLUC029_RS04300 (LLUC029_04305) | - | 834393..834629 (+) | 237 | WP_021165561.1 | DUF1408 domain-containing protein | - |
| LLUC029_RS04305 (LLUC029_04310) | - | 834727..835125 (+) | 399 | WP_032950580.1 | hypothetical protein | - |
| LLUC029_RS04310 (LLUC029_04315) | - | 835134..835892 (+) | 759 | WP_032950582.1 | Rad52/Rad22 family DNA repair protein | - |
| LLUC029_RS04315 (LLUC029_04320) | ssb | 835885..836310 (+) | 426 | WP_032950583.1 | single-stranded DNA-binding protein | Machinery gene |
| LLUC029_RS04320 (LLUC029_04325) | - | 836438..837244 (+) | 807 | WP_063282457.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLUC029_RS04325 (LLUC029_04330) | - | 837254..838144 (+) | 891 | WP_021165556.1 | ATP-binding protein | - |
| LLUC029_RS04330 (LLUC029_04335) | - | 838153..838317 (+) | 165 | WP_021165555.1 | hypothetical protein | - |
| LLUC029_RS04335 (LLUC029_04340) | - | 838307..838726 (+) | 420 | WP_050595599.1 | hypothetical protein | - |
| LLUC029_RS04340 (LLUC029_04345) | - | 838727..838965 (+) | 239 | Protein_845 | DUF1031 family protein | - |
| LLUC029_RS04345 (LLUC029_04350) | - | 839288..839629 (+) | 342 | WP_058212883.1 | hypothetical protein | - |
| LLUC029_RS04350 (LLUC029_04355) | - | 839601..839990 (+) | 390 | WP_032950595.1 | YopX family protein | - |
| LLUC029_RS04355 (LLUC029_04360) | - | 839987..840193 (+) | 207 | WP_032950598.1 | DUF1125 domain-containing protein | - |
| LLUC029_RS04360 (LLUC029_04365) | - | 840186..840761 (+) | 576 | WP_032950601.1 | DUF1642 domain-containing protein | - |
| LLUC029_RS04365 (LLUC029_04370) | istA | 840886..842109 (+) | 1224 | WP_003331415.1 | IS21-like element IS712 family transposase | - |
| LLUC029_RS04370 (LLUC029_04375) | istB | 842121..842879 (+) | 759 | WP_003331414.1 | IS21-like element IS712 family helper ATPase IstB | - |
| LLUC029_RS04375 (LLUC029_04380) | - | 842961..843068 (+) | 108 | Protein_852 | LysM peptidoglycan-binding domain-containing protein | - |
| LLUC029_RS04380 (LLUC029_04385) | - | 843143..844527 (+) | 1385 | WP_332372292.1 | IS3 family transposase | - |
| LLUC029_RS04385 (LLUC029_04390) | - | 844803..844964 (+) | 162 | WP_268743976.1 | bacteriophage holin | - |
| LLUC029_RS04395 (LLUC029_04400) | - | 845793..845993 (+) | 201 | WP_011676499.1 | hypothetical protein | - |
| LLUC029_RS04400 (LLUC029_04405) | - | 845975..846865 (-) | 891 | WP_081196073.1 | IS982-like element IS982B family transposase | - |
| LLUC029_RS04405 (LLUC029_04410) | - | 847080..847304 (+) | 225 | WP_032950344.1 | garvicin Q family class II bacteriocin | - |
| LLUC029_RS04410 (LLUC029_04415) | - | 847309..847614 (+) | 306 | WP_011834820.1 | bacteriocin immunity protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15656.42 Da Isoelectric Point: 5.1972
>NTDB_id=851340 LLUC029_RS04315 WP_032950583.1 835885..836310(+) (ssb) [Lactococcus cremoris strain UC029]
MINNVILVGRITKEPELRYTPQNKAVAAFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
MINNVILVGRITKEPELRYTPQNKAVAAFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=851340 LLUC029_RS04315 WP_032950583.1 835885..836310(+) (ssb) [Lactococcus cremoris strain UC029]
ATGATTAACAATGTCATTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CGCTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGC
AACTATGAGAATCAACAAGGGCAACGGGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCATTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CGCTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGC
AACTATGAGAATCAACAAGGGCAACGGGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.529 |
100 |
0.645 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.681 |
100 |
0.447 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.972 |
100 |
0.44 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.692 |
73.759 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |
| ssb | Vibrio cholerae strain A1552 |
29.651 |
100 |
0.362 |