Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KUN2590_RS03405 | Genome accession | NZ_AP023387 |
| Coordinates | 639107..639526 (+) | Length | 139 a.a. |
| NCBI ID | WP_011054759.1 | Uniprot ID | A0A5S4TJJ6 |
| Organism | Streptococcus pyogenes strain NIH34 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 630810..672321 | 639107..639526 | within | 0 |
Gene organization within MGE regions
Location: 630810..672321
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KUN2590_RS03315 (SPNIH34_06000) | - | 630810..631907 (-) | 1098 | WP_015967409.1 | site-specific integrase | - |
| KUN2590_RS03320 (SPNIH34_06010) | - | 632083..632604 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| KUN2590_RS03325 (SPNIH34_06020) | - | 632615..632995 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KUN2590_RS03330 (SPNIH34_06030) | - | 633009..633362 (-) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| KUN2590_RS03335 (SPNIH34_06040) | - | 634164..634355 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| KUN2590_RS03340 (SPNIH34_06050) | - | 634366..635094 (+) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| KUN2590_RS03345 (SPNIH34_06060) | - | 635127..635276 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| KUN2590_RS03350 (SPNIH34_06070) | - | 635273..635473 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| KUN2590_RS03355 | - | 635549..635716 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| KUN2590_RS03360 (SPNIH34_06090) | - | 635962..636219 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| KUN2590_RS03365 (SPNIH34_06100) | - | 636248..636433 (+) | 186 | WP_011054765.1 | hypothetical protein | - |
| KUN2590_RS03370 (SPNIH34_06110) | - | 636527..636784 (+) | 258 | WP_011106684.1 | hypothetical protein | - |
| KUN2590_RS03375 (SPNIH34_06120) | - | 636906..637319 (+) | 414 | WP_011054763.1 | DnaD domain protein | - |
| KUN2590_RS03380 (SPNIH34_06130) | - | 637300..637533 (+) | 234 | WP_011054762.1 | hypothetical protein | - |
| KUN2590_RS03385 | - | 637530..637670 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| KUN2590_RS03390 (SPNIH34_06140) | - | 637681..637935 (+) | 255 | WP_011054761.1 | hypothetical protein | - |
| KUN2590_RS03395 (SPNIH34_06150) | - | 637957..638439 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| KUN2590_RS03400 (SPNIH34_06160) | - | 638440..639114 (+) | 675 | WP_011054760.1 | ERF family protein | - |
| KUN2590_RS03405 (SPNIH34_06170) | ssbA | 639107..639526 (+) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| KUN2590_RS03410 (SPNIH34_06180) | - | 639532..639735 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| KUN2590_RS03415 (SPNIH34_06190) | - | 639735..640175 (+) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KUN2590_RS03420 (SPNIH34_06200) | - | 640172..640528 (+) | 357 | WP_011054757.1 | hypothetical protein | - |
| KUN2590_RS03425 (SPNIH34_06210) | - | 640525..640776 (+) | 252 | WP_011054756.1 | hypothetical protein | - |
| KUN2590_RS03430 (SPNIH34_06220) | - | 640770..641054 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| KUN2590_RS03435 (SPNIH34_06230) | - | 641051..641320 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| KUN2590_RS03440 (SPNIH34_06240) | - | 641330..641734 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| KUN2590_RS03445 (SPNIH34_06250) | - | 641731..641901 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| KUN2590_RS03450 (SPNIH34_06260) | - | 641898..642404 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| KUN2590_RS03455 (SPNIH34_06270) | - | 642401..642571 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| KUN2590_RS03460 (SPNIH34_06280) | - | 642845..643285 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KUN2590_RS03465 | - | 643924..644181 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| KUN2590_RS03470 (SPNIH34_06290) | - | 644262..644780 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| KUN2590_RS03475 (SPNIH34_06300) | - | 644759..645436 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| KUN2590_RS03480 (SPNIH34_06310) | - | 645445..645828 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| KUN2590_RS03485 (SPNIH34_06320) | - | 645889..646266 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| KUN2590_RS03490 (SPNIH34_06330) | - | 646308..646790 (+) | 483 | WP_015967410.1 | hypothetical protein | - |
| KUN2590_RS03495 (SPNIH34_06340) | - | 646873..648084 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| KUN2590_RS03500 (SPNIH34_06350) | - | 648098..649600 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| KUN2590_RS03505 (SPNIH34_06360) | - | 649605..651083 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| KUN2590_RS03510 (SPNIH34_06370) | - | 651055..651294 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| KUN2590_RS03515 (SPNIH34_06380) | - | 651356..651622 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| KUN2590_RS03520 (SPNIH34_06390) | - | 651748..652362 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| KUN2590_RS03525 (SPNIH34_06400) | - | 652366..653184 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| KUN2590_RS03530 (SPNIH34_06410) | - | 653238..653654 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| KUN2590_RS03535 (SPNIH34_06420) | - | 653644..653976 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| KUN2590_RS03540 (SPNIH34_06430) | - | 653976..654332 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| KUN2590_RS03545 (SPNIH34_06440) | - | 654329..654727 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| KUN2590_RS03550 (SPNIH34_06450) | - | 654727..655212 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| KUN2590_RS03555 (SPNIH34_06460) | - | 655251..655685 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| KUN2590_RS03560 (SPNIH34_06470) | - | 655689..656270 (+) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| KUN2590_RS03565 (SPNIH34_06480) | - | 656260..659520 (+) | 3261 | WP_011054738.1 | tape measure protein | - |
| KUN2590_RS03570 (SPNIH34_06490) | - | 659517..660233 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| KUN2590_RS03575 (SPNIH34_06500) | - | 660230..662374 (+) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| KUN2590_RS03580 (SPNIH34_06510) | hylP | 662371..663384 (+) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| KUN2590_RS03585 (SPNIH34_06520) | - | 663399..665282 (+) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| KUN2590_RS03590 (SPNIH34_06530) | - | 665294..665725 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| KUN2590_RS03595 (SPNIH34_06540) | - | 665728..666339 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| KUN2590_RS03600 (SPNIH34_06550) | - | 666350..666646 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| KUN2590_RS03605 (SPNIH34_06560) | - | 666643..666828 (+) | 186 | WP_011054731.1 | holin | - |
| KUN2590_RS03610 (SPNIH34_06570) | - | 666939..668141 (+) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| KUN2590_RS03615 (SPNIH34_06580) | - | 668281..668805 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| KUN2590_RS03620 (SPNIH34_06590) | - | 668793..669659 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| KUN2590_RS03625 (SPNIH34_06600) | spek | 669963..670742 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| KUN2590_RS03630 (SPNIH34_06610) | - | 671218..671793 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| KUN2590_RS03635 (SPNIH34_06620) | prx | 672139..672321 (+) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.29 Da Isoelectric Point: 4.8660
>NTDB_id=82675 KUN2590_RS03405 WP_011054759.1 639107..639526(+) (ssbA) [Streptococcus pyogenes strain NIH34]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=82675 KUN2590_RS03405 WP_011054759.1 639107..639526(+) (ssbA) [Streptococcus pyogenes strain NIH34]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.857 |
100 |
0.691 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.683 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.043 |
100 |
0.46 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.324 |
100 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
79.856 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.388 |
| ssb | Glaesserella parasuis strain SC1401 |
28.814 |
100 |
0.367 |